Anti ACOT1 pAb (ATL-HPA043705)

Atlas Antibodies

Catalog No.:
ATL-HPA043705-25
Shipping:
Calculated at Checkout
$324.00
Adding to cart… The item has been added
Protein Description: acyl-CoA thioesterase 1
Gene Name: ACOT1
Alternative Gene Name: ACH2, CTE-1, LACH2
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000021228: 73%, ENSRNOG00000053460: 70%
Entrez Gene ID: 641371
Uniprot ID: Q86TX2
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, ICC, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen YKGETLPPVGVNRNRIKVTKDGYADIVDVLNSPLEGPDQKSFIPVERAESTFLFLVGQDDHNWK
Gene Sequence YKGETLPPVGVNRNRIKVTKDGYADIVDVLNSPLEGPDQKSFIPVERAESTFLFLVGQDDHNWK
Gene ID - Mouse ENSMUSG00000021228
Gene ID - Rat ENSRNOG00000053460
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti ACOT1 pAb (ATL-HPA043705)
Datasheet Anti ACOT1 pAb (ATL-HPA043705) Datasheet (External Link)
Vendor Page Anti ACOT1 pAb (ATL-HPA043705) at Atlas Antibodies

Documents & Links for Anti ACOT1 pAb (ATL-HPA043705)
Datasheet Anti ACOT1 pAb (ATL-HPA043705) Datasheet (External Link)
Vendor Page Anti ACOT1 pAb (ATL-HPA043705)