Anti ACOT1 pAb (ATL-HPA043705)
Atlas Antibodies
- Catalog No.:
- ATL-HPA043705-25
- Shipping:
- Calculated at Checkout
$324.00
Gene Name: ACOT1
Alternative Gene Name: ACH2, CTE-1, LACH2
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000021228: 73%, ENSRNOG00000053460: 70%
Entrez Gene ID: 641371
Uniprot ID: Q86TX2
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | WB, ICC, IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | YKGETLPPVGVNRNRIKVTKDGYADIVDVLNSPLEGPDQKSFIPVERAESTFLFLVGQDDHNWK |
| Gene Sequence | YKGETLPPVGVNRNRIKVTKDGYADIVDVLNSPLEGPDQKSFIPVERAESTFLFLVGQDDHNWK |
| Gene ID - Mouse | ENSMUSG00000021228 |
| Gene ID - Rat | ENSRNOG00000053460 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti ACOT1 pAb (ATL-HPA043705) | |
| Datasheet | Anti ACOT1 pAb (ATL-HPA043705) Datasheet (External Link) |
| Vendor Page | Anti ACOT1 pAb (ATL-HPA043705) at Atlas Antibodies |
| Documents & Links for Anti ACOT1 pAb (ATL-HPA043705) | |
| Datasheet | Anti ACOT1 pAb (ATL-HPA043705) Datasheet (External Link) |
| Vendor Page | Anti ACOT1 pAb (ATL-HPA043705) |