Anti ACOT1 pAb (ATL-HPA043705)

Atlas Antibodies

Catalog No.: ATL-HPA043705-25

Protein Description: acyl-CoA thioesterase 1
Gene Name: ACOT1
Alternative Gene Name: ACH2, CTE-1, LACH2
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000021228: 73%, ENSRNOG00000053460: 70%
Entrez Gene ID: 641371
Uniprot ID: Q86TX2
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, ICC, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: YKGETLPPVGVNRNRIKVTKDGYADIVDVLNSPLEGPDQKSFIPVERAESTFLFLVGQDDHNWK
• Gene Sequence: YKGETLPPVGVNRNRIKVTKDGYADIVDVLNSPLEGPDQKSFIPVERAESTFLFLVGQDDHNWK
• Gene ID - Mouse: ENSMUSG00000021228
• Gene ID - Rat: ENSRNOG00000053460
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.