Anti ACO2 pAb (ATL-HPA001097 w/enhanced validation)
Atlas Antibodies
- Catalog No.:
- ATL-HPA001097-25
- Shipping:
- Calculated at Checkout
$423.00
Gene Name: ACO2
Alternative Gene Name: ACONM
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000022477: 97%, ENSRNOG00000024128: 97%
Entrez Gene ID: 50
Uniprot ID: Q99798
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | WB, ICC, IHC |
| Reactivity | Human, Mouse, Rat |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | GKKFRLEAPDADELPKGEFDPGQDTYQHPPKDSSGQHVDVSPTSQRLQLLEPFDKWDGKDLEDLQILIKVKGKCTTDHISAAGPWLKFRGHLDNISNNLLIGAINIENGKANSVRNAVTQEFGPVPDTARYYKKHGIRWVVIGDENYGEG |
| Gene Sequence | GKKFRLEAPDADELPKGEFDPGQDTYQHPPKDSSGQHVDVSPTSQRLQLLEPFDKWDGKDLEDLQILIKVKGKCTTDHISAAGPWLKFRGHLDNISNNLLIGAINIENGKANSVRNAVTQEFGPVPDTARYYKKHGIRWVVIGDENYGEG |
| Gene ID - Mouse | ENSMUSG00000022477 |
| Gene ID - Rat | ENSRNOG00000024128 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti ACO2 pAb (ATL-HPA001097 w/enhanced validation) | |
| Datasheet | Anti ACO2 pAb (ATL-HPA001097 w/enhanced validation) Datasheet (External Link) |
| Vendor Page | Anti ACO2 pAb (ATL-HPA001097 w/enhanced validation) at Atlas Antibodies |
| Documents & Links for Anti ACO2 pAb (ATL-HPA001097 w/enhanced validation) | |
| Datasheet | Anti ACO2 pAb (ATL-HPA001097 w/enhanced validation) Datasheet (External Link) |
| Vendor Page | Anti ACO2 pAb (ATL-HPA001097 w/enhanced validation) |
| Citations for Anti ACO2 pAb (ATL-HPA001097 w/enhanced validation) – 6 Found |
| Stumpf, Sina K; Berghoff, Stefan A; Trevisiol, Andrea; Spieth, Lena; Düking, Tim; Schneider, Lennart V; Schlaphoff, Lennart; Dreha-Kulaczewski, Steffi; Bley, Annette; Burfeind, Dinah; Kusch, Kathrin; Mitkovski, Miso; Ruhwedel, Torben; Guder, Philipp; Röhse, Heiko; Denecke, Jonas; Gärtner, Jutta; Möbius, Wiebke; Nave, Klaus-Armin; Saher, Gesine. Ketogenic diet ameliorates axonal defects and promotes myelination in Pelizaeus-Merzbacher disease. Acta Neuropathologica. 2019;138(1):147-161. PubMed |
| Medina-Carbonero, Marta; Sanz-Alcázar, Arabela; Britti, Elena; Delaspre, Fabien; Cabiscol, Elisa; Ros, Joaquim; Tamarit, Jordi. Mice harboring the FXN I151F pathological point mutation present decreased frataxin levels, a Friedreich ataxia-like phenotype, and mitochondrial alterations. Cellular And Molecular Life Sciences : Cmls. 2022;79(2):74. PubMed |
| Cantu, David; Fulton, Ruth E; Drechsel, Derek A; Patel, Manisha. Mitochondrial aconitase knockdown attenuates paraquat-induced dopaminergic cell death via decreased cellular metabolism and release of iron and H₂O₂. Journal Of Neurochemistry. 2011;118(1):79-92. PubMed |
| Ilgen, Peter; Stoldt, Stefan; Conradi, Lena-Christin; Wurm, Christian Andreas; Rüschoff, Josef; Ghadimi, B Michael; Liersch, Torsten; Jakobs, Stefan. STED super-resolution microscopy of clinical paraffin-embedded human rectal cancer tissue. Plos One. 9(7):e101563. PubMed |
| Latonen, Leena; Afyounian, Ebrahim; Jylhä, Antti; Nättinen, Janika; Aapola, Ulla; Annala, Matti; Kivinummi, Kati K; Tammela, Teuvo T L; Beuerman, Roger W; Uusitalo, Hannu; Nykter, Matti; Visakorpi, Tapio. Integrative proteomics in prostate cancer uncovers robustness against genomic and transcriptomic aberrations during disease progression. Nature Communications. 2018;9(1):1176. PubMed |
| Mirhadi, Shideh; Zhang, Wen; Pham, Nhu-An; Karimzadeh, Fereshteh; Pintilie, Melania; Tong, Jiefei; Taylor, Paul; Krieger, Jonathan; Pitcher, Bethany; Sykes, Jenna; Wybenga-Groot, Leanne; Fladd, Christopher; Xu, Jing; Wang, Tao; Cabanero, Michael; Li, Ming; Weiss, Jessica; Sakashita, Shingo; Zaslaver, Olga; Yu, Man; Caudy, Amy A; St-Pierre, Julie; Hawkins, Cynthia; Kislinger, Thomas; Liu, Geoffrey; Shepherd, Frances A; Tsao, Ming-Sound; Moran, Michael F. Mitochondrial Aconitase ACO2 Links Iron Homeostasis with Tumorigenicity in Non-Small Cell Lung Cancer. Molecular Cancer Research : Mcr. 2023;21(1):36-50. PubMed |