Anti ACO1 pAb (ATL-HPA024157)

Atlas Antibodies

SKU:
ATL-HPA024157-25
  • Immunohistochemical staining of human kidney shows strong cytoplasmic positivity in tubular cells.
Shipping:
Calculated at Checkout
$395.00
Adding to cart… The item has been added
Protein Description: aconitase 1, soluble
Gene Name: ACO1
Alternative Gene Name: IREB1, IREBP, IRP1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000028405: 89%, ENSRNOG00000005849: 89%
Entrez Gene ID: 48
Uniprot ID: P21399
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen FEKEPLGVNAKGQQVFLKDIWPTRDEIQAVERQYVIPGMFKEVYQKIETVNESWNALATPSDKLFFWNSKSTYIKSPPFFENLTLDLQP
Gene Sequence FEKEPLGVNAKGQQVFLKDIWPTRDEIQAVERQYVIPGMFKEVYQKIETVNESWNALATPSDKLFFWNSKSTYIKSPPFFENLTLDLQP
Gene ID - Mouse ENSMUSG00000028405
Gene ID - Rat ENSRNOG00000005849
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.


Documents & Links for Anti ACO1 pAb (ATL-HPA024157)
Datasheet Anti ACO1 pAb (ATL-HPA024157) Datasheet (External Link)
Vendor Page Anti ACO1 pAb (ATL-HPA024157) at Atlas Antibodies

Documents & Links for Anti ACO1 pAb (ATL-HPA024157)
Datasheet Anti ACO1 pAb (ATL-HPA024157) Datasheet (External Link)
Vendor Page Anti ACO1 pAb (ATL-HPA024157)