Anti ACO1 pAb (ATL-HPA024157)
Atlas Antibodies
- SKU:
- ATL-HPA024157-25
- Shipping:
- Calculated at Checkout
$395.00
Gene Name: ACO1
Alternative Gene Name: IREB1, IREBP, IRP1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000028405: 89%, ENSRNOG00000005849: 89%
Entrez Gene ID: 48
Uniprot ID: P21399
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | IHC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | FEKEPLGVNAKGQQVFLKDIWPTRDEIQAVERQYVIPGMFKEVYQKIETVNESWNALATPSDKLFFWNSKSTYIKSPPFFENLTLDLQP |
Gene Sequence | FEKEPLGVNAKGQQVFLKDIWPTRDEIQAVERQYVIPGMFKEVYQKIETVNESWNALATPSDKLFFWNSKSTYIKSPPFFENLTLDLQP |
Gene ID - Mouse | ENSMUSG00000028405 |
Gene ID - Rat | ENSRNOG00000005849 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links for Anti ACO1 pAb (ATL-HPA024157) | |
Datasheet | Anti ACO1 pAb (ATL-HPA024157) Datasheet (External Link) |
Vendor Page | Anti ACO1 pAb (ATL-HPA024157) at Atlas Antibodies |
Documents & Links for Anti ACO1 pAb (ATL-HPA024157) | |
Datasheet | Anti ACO1 pAb (ATL-HPA024157) Datasheet (External Link) |
Vendor Page | Anti ACO1 pAb (ATL-HPA024157) |