Anti ACO1 pAb (ATL-HPA019371 w/enhanced validation)

Atlas Antibodies

Catalog No.:
ATL-HPA019371-25
Shipping:
Calculated at Checkout
$395.00
Adding to cart… The item has been added
Protein Description: aconitase 1, soluble
Gene Name: ACO1
Alternative Gene Name: IREB1, IREBP, IRP1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000028405: 89%, ENSRNOG00000005849: 90%
Entrez Gene ID: 48
Uniprot ID: P21399
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, ICC, IHC
Reactivity Human, Mouse, Rat
Clonality Polyclonal
Host Rabbit
Immunogen YERIHRSNLVGMGVIPLEYLPGENADALGLTGQERYTIIIPENLKPQMKVQVKLDTGKTFQAVMRFDTDVELTYFLNGGILNYMIRKMAK
Gene Sequence YERIHRSNLVGMGVIPLEYLPGENADALGLTGQERYTIIIPENLKPQMKVQVKLDTGKTFQAVMRFDTDVELTYFLNGGILNYMIRKMAK
Gene ID - Mouse ENSMUSG00000028405
Gene ID - Rat ENSRNOG00000005849
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti ACO1 pAb (ATL-HPA019371 w/enhanced validation)
Datasheet Anti ACO1 pAb (ATL-HPA019371 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti ACO1 pAb (ATL-HPA019371 w/enhanced validation) at Atlas Antibodies

Documents & Links for Anti ACO1 pAb (ATL-HPA019371 w/enhanced validation)
Datasheet Anti ACO1 pAb (ATL-HPA019371 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti ACO1 pAb (ATL-HPA019371 w/enhanced validation)
Citations for Anti ACO1 pAb (ATL-HPA019371 w/enhanced validation) – 2 Found
Haro, Kurtis J; Sheth, Aneesh; Scheinberg, David A. Dysregulation of IRP1-mediated iron metabolism causes gamma ray-specific radioresistance in leukemia cells. Plos One. 7(11):e48841.  PubMed
Kung, Woon-Man; Lin, Chai-Ching; Chen, Wei-Jung; Jiang, Li-Lin; Sun, Yu-Yo; Hsieh, Kuang-Hui; Lin, Muh-Shi. Anti-Inflammatory CDGSH Iron-Sulfur Domain 2: A Biomarker of Central Nervous System Insult in Cellular, Animal Models and Patients. Biomedicines. 2022;10(4)  PubMed