Anti ACO1 pAb (ATL-HPA019371 w/enhanced validation)

Atlas Antibodies

SKU: ATL-HPA019371-25

• 
• 
• 

Protein Description: aconitase 1, soluble
Gene Name: ACO1
Alternative Gene Name: IREB1, IREBP, IRP1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000028405: 89%, ENSRNOG00000005849: 90%
Entrez Gene ID: 48
Uniprot ID: P21399
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, ICC, IHC
• Reactivity: Human, Mouse, Rat
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: YERIHRSNLVGMGVIPLEYLPGENADALGLTGQERYTIIIPENLKPQMKVQVKLDTGKTFQAVMRFDTDVELTYFLNGGILNYMIRKMAK
• Gene Sequence: YERIHRSNLVGMGVIPLEYLPGENADALGLTGQERYTIIIPENLKPQMKVQVKLDTGKTFQAVMRFDTDVELTYFLNGGILNYMIRKMAK
• Gene ID - Mouse: ENSMUSG00000028405
• Gene ID - Rat: ENSRNOG00000005849
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Citations for Anti ACO1 pAb (ATL-HPA019371 w/enhanced validation) – 2 Found

Haro, Kurtis J; Sheth, Aneesh; Scheinberg, David A. Dysregulation of IRP1-mediated iron metabolism causes gamma ray-specific radioresistance in leukemia cells. Plos One. 7(11):e48841. 

Kung, Woon-Man; Lin, Chai-Ching; Chen, Wei-Jung; Jiang, Li-Lin; Sun, Yu-Yo; Hsieh, Kuang-Hui; Lin, Muh-Shi. Anti-Inflammatory CDGSH Iron-Sulfur Domain 2: A Biomarker of Central Nervous System Insult in Cellular, Animal Models and Patients. Biomedicines. 2022;10(4)