Anti ACLY pAb (ATL-HPA022434 w/enhanced validation)

Atlas Antibodies

Catalog No.:
ATL-HPA022434-25
Shipping:
Calculated at Checkout
$423.00
Adding to cart… The item has been added
Protein Description: ATP citrate lyase
Gene Name: ACLY
Alternative Gene Name: ACL, ATPCL, CLATP
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000020917: 97%, ENSRNOG00000016924: 97%
Entrez Gene ID: 47
Uniprot ID: P53396
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, ICC, IHC
Reactivity Human, Mouse, Rat
Clonality Polyclonal
Host Rabbit
Immunogen AEEFYVCIYATREGDYVLFHHEGGVDVGDVDAKAQKLLVGVDEKLNPEDIKKHLLVHAPEDKKEILASFISGLFNFYEDLYFTYLEINPLVVTKDGV
Gene Sequence AEEFYVCIYATREGDYVLFHHEGGVDVGDVDAKAQKLLVGVDEKLNPEDIKKHLLVHAPEDKKEILASFISGLFNFYEDLYFTYLEINPLVVTKDGV
Gene ID - Mouse ENSMUSG00000020917
Gene ID - Rat ENSRNOG00000016924
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti ACLY pAb (ATL-HPA022434 w/enhanced validation)
Datasheet Anti ACLY pAb (ATL-HPA022434 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti ACLY pAb (ATL-HPA022434 w/enhanced validation) at Atlas Antibodies

Documents & Links for Anti ACLY pAb (ATL-HPA022434 w/enhanced validation)
Datasheet Anti ACLY pAb (ATL-HPA022434 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti ACLY pAb (ATL-HPA022434 w/enhanced validation)
Citations for Anti ACLY pAb (ATL-HPA022434 w/enhanced validation) – 3 Found
Göttgens, Eva-Leonne; van den Heuvel, Corina Nam; de Jong, Monique C; Kaanders, Johannes Ham; Leenders, William Pj; Ansems, Marleen; Bussink, Johan; Span, Paul N. ACLY (ATP Citrate Lyase) Mediates Radioresistance in Head and Neck Squamous Cell Carcinomas and is a Novel Predictive Radiotherapy Biomarker. Cancers. 2019;11(12)  PubMed
Bosc, Claudie; Broin, Nicolas; Fanjul, Marjorie; Saland, Estelle; Farge, Thomas; Courdy, Charly; Batut, Aurélie; Masoud, Rawand; Larrue, Clément; Skuli, Sarah; Espagnolle, Nicolas; Pagès, Jean-Christophe; Carrier, Alice; Bost, Frédéric; Bertrand-Michel, Justine; Tamburini, Jérôme; Récher, Christian; Bertoli, Sarah; Mansat-De Mas, Véronique; Manenti, Stéphane; Sarry, Jean-Emmanuel; Joffre, Carine. Autophagy regulates fatty acid availability for oxidative phosphorylation through mitochondria-endoplasmic reticulum contact sites. Nature Communications. 2020;11(1):4056.  PubMed
Liu, Danfei; Zhang, Tongyue; Chen, Xiaoping; Zhang, Bixiang; Wang, Yijun; Xie, Meng; Ji, Xiaoyu; Sun, Mengyu; Huang, Wenjie; Xia, Limin. ONECUT2 facilitates hepatocellular carcinoma metastasis by transcriptionally upregulating FGF2 and ACLY. Cell Death & Disease. 2021;12(12):1113.  PubMed