Anti ACLY pAb (ATL-HPA022434 w/enhanced validation)
Atlas Antibodies
- Catalog No.:
- ATL-HPA022434-25
- Shipping:
- Calculated at Checkout
$423.00
Gene Name: ACLY
Alternative Gene Name: ACL, ATPCL, CLATP
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000020917: 97%, ENSRNOG00000016924: 97%
Entrez Gene ID: 47
Uniprot ID: P53396
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | WB, ICC, IHC |
| Reactivity | Human, Mouse, Rat |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | AEEFYVCIYATREGDYVLFHHEGGVDVGDVDAKAQKLLVGVDEKLNPEDIKKHLLVHAPEDKKEILASFISGLFNFYEDLYFTYLEINPLVVTKDGV |
| Gene Sequence | AEEFYVCIYATREGDYVLFHHEGGVDVGDVDAKAQKLLVGVDEKLNPEDIKKHLLVHAPEDKKEILASFISGLFNFYEDLYFTYLEINPLVVTKDGV |
| Gene ID - Mouse | ENSMUSG00000020917 |
| Gene ID - Rat | ENSRNOG00000016924 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti ACLY pAb (ATL-HPA022434 w/enhanced validation) | |
| Datasheet | Anti ACLY pAb (ATL-HPA022434 w/enhanced validation) Datasheet (External Link) |
| Vendor Page | Anti ACLY pAb (ATL-HPA022434 w/enhanced validation) at Atlas Antibodies |
| Documents & Links for Anti ACLY pAb (ATL-HPA022434 w/enhanced validation) | |
| Datasheet | Anti ACLY pAb (ATL-HPA022434 w/enhanced validation) Datasheet (External Link) |
| Vendor Page | Anti ACLY pAb (ATL-HPA022434 w/enhanced validation) |
| Citations for Anti ACLY pAb (ATL-HPA022434 w/enhanced validation) – 3 Found |
| Göttgens, Eva-Leonne; van den Heuvel, Corina Nam; de Jong, Monique C; Kaanders, Johannes Ham; Leenders, William Pj; Ansems, Marleen; Bussink, Johan; Span, Paul N. ACLY (ATP Citrate Lyase) Mediates Radioresistance in Head and Neck Squamous Cell Carcinomas and is a Novel Predictive Radiotherapy Biomarker. Cancers. 2019;11(12) PubMed |
| Bosc, Claudie; Broin, Nicolas; Fanjul, Marjorie; Saland, Estelle; Farge, Thomas; Courdy, Charly; Batut, Aurélie; Masoud, Rawand; Larrue, Clément; Skuli, Sarah; Espagnolle, Nicolas; Pagès, Jean-Christophe; Carrier, Alice; Bost, Frédéric; Bertrand-Michel, Justine; Tamburini, Jérôme; Récher, Christian; Bertoli, Sarah; Mansat-De Mas, Véronique; Manenti, Stéphane; Sarry, Jean-Emmanuel; Joffre, Carine. Autophagy regulates fatty acid availability for oxidative phosphorylation through mitochondria-endoplasmic reticulum contact sites. Nature Communications. 2020;11(1):4056. PubMed |
| Liu, Danfei; Zhang, Tongyue; Chen, Xiaoping; Zhang, Bixiang; Wang, Yijun; Xie, Meng; Ji, Xiaoyu; Sun, Mengyu; Huang, Wenjie; Xia, Limin. ONECUT2 facilitates hepatocellular carcinoma metastasis by transcriptionally upregulating FGF2 and ACLY. Cell Death & Disease. 2021;12(12):1113. PubMed |