Anti ACKR3 pAb (ATL-HPA049718)
Atlas Antibodies
- Catalog No.:
- ATL-HPA049718-25
- Shipping:
- Calculated at Checkout
$395.00
Gene Name: ACKR3
Alternative Gene Name: CMKOR1, CXCR7, GPR159, RDC1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000044337: 84%, ENSRNOG00000019622: 84%
Entrez Gene ID: 57007
Uniprot ID: P25106
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | LHLFDYSEPGNFSDISWPCNSSDCIVVDTVMCPNMPNKSVLLY |
| Gene Sequence | LHLFDYSEPGNFSDISWPCNSSDCIVVDTVMCPNMPNKSVLLY |
| Gene ID - Mouse | ENSMUSG00000044337 |
| Gene ID - Rat | ENSRNOG00000019622 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti ACKR3 pAb (ATL-HPA049718) | |
| Datasheet | Anti ACKR3 pAb (ATL-HPA049718) Datasheet (External Link) |
| Vendor Page | Anti ACKR3 pAb (ATL-HPA049718) at Atlas Antibodies |
| Documents & Links for Anti ACKR3 pAb (ATL-HPA049718) | |
| Datasheet | Anti ACKR3 pAb (ATL-HPA049718) Datasheet (External Link) |
| Vendor Page | Anti ACKR3 pAb (ATL-HPA049718) |
| Citations for Anti ACKR3 pAb (ATL-HPA049718) – 1 Found |
| Fan, Li-Ching; Jeng, Yung-Ming; Lu, Yueh-Tong; Lien, Huang-Chun. SPOCK1 Is a Novel Transforming Growth Factor-β-Induced Myoepithelial Marker That Enhances Invasion and Correlates with Poor Prognosis in Breast Cancer. Plos One. 11(9):e0162933. PubMed |