Anti ACKR3 pAb (ATL-HPA032003)

Atlas Antibodies

Catalog No.:
ATL-HPA032003-25
Shipping:
Calculated at Checkout
$395.00
Adding to cart… The item has been added
Protein Description: atypical chemokine receptor 3
Gene Name: ACKR3
Alternative Gene Name: CMKOR1, CXCR7, GPR159, RDC1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000044337: 84%, ENSRNOG00000019622: 84%
Entrez Gene ID: 57007
Uniprot ID: P25106
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen LHLFDYSEPGNFSDISWPCNSSDCIVVDTVMCPNMPNKSVLLY
Gene Sequence LHLFDYSEPGNFSDISWPCNSSDCIVVDTVMCPNMPNKSVLLY
Gene ID - Mouse ENSMUSG00000044337
Gene ID - Rat ENSRNOG00000019622
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti ACKR3 pAb (ATL-HPA032003)
Datasheet Anti ACKR3 pAb (ATL-HPA032003) Datasheet (External Link)
Vendor Page Anti ACKR3 pAb (ATL-HPA032003) at Atlas Antibodies

Documents & Links for Anti ACKR3 pAb (ATL-HPA032003)
Datasheet Anti ACKR3 pAb (ATL-HPA032003) Datasheet (External Link)
Vendor Page Anti ACKR3 pAb (ATL-HPA032003)