Anti ACKR2 pAb (ATL-HPA013819 w/enhanced validation)

Atlas Antibodies

Catalog No.: ATL-HPA013819-25

Protein Description: atypical chemokine receptor 2
Gene Name: ACKR2
Alternative Gene Name: CCBP2, CCR10, CCR9, CMKBR9, D6
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000044534: 56%, ENSRNOG00000019472: 56%
Entrez Gene ID: 1238
Uniprot ID: O00590
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: QYLKAFLAAVLGWHLAPGTAQASLSSCSESSILTAQEEMTGMNDLGERQSENYPNKEDVGNKSA
• Gene Sequence: QYLKAFLAAVLGWHLAPGTAQASLSSCSESSILTAQEEMTGMNDLGERQSENYPNKEDVGNKSA
• Gene ID - Mouse: ENSMUSG00000044534
• Gene ID - Rat: ENSRNOG00000019472
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Citations for Anti ACKR2 pAb (ATL-HPA013819 w/enhanced validation) – 1 Found

Baldwin, Helen M; Singh, Mark D; Codullo, Veronica; King, Vicky; Wilson, Hilary; McInnes, Iain; Graham, Gerard J. Elevated ACKR2 expression is a common feature of inflammatory arthropathies. Rheumatology (Oxford, England). 2017;56(9):1607-1617.