Anti ACKR2 pAb (ATL-HPA013819 w/enhanced validation)
Atlas Antibodies
- SKU:
- ATL-HPA013819-25
- Shipping:
- Calculated at Checkout
$303.00
Gene Name: ACKR2
Alternative Gene Name: CCBP2, CCR10, CCR9, CMKBR9, D6
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000044534: 56%, ENSRNOG00000019472: 56%
Entrez Gene ID: 1238
Uniprot ID: O00590
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | QYLKAFLAAVLGWHLAPGTAQASLSSCSESSILTAQEEMTGMNDLGERQSENYPNKEDVGNKSA |
| Gene Sequence | QYLKAFLAAVLGWHLAPGTAQASLSSCSESSILTAQEEMTGMNDLGERQSENYPNKEDVGNKSA |
| Gene ID - Mouse | ENSMUSG00000044534 |
| Gene ID - Rat | ENSRNOG00000019472 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti ACKR2 pAb (ATL-HPA013819 w/enhanced validation) | |
| Datasheet | Anti ACKR2 pAb (ATL-HPA013819 w/enhanced validation) Datasheet (External Link) |
| Vendor Page | Anti ACKR2 pAb (ATL-HPA013819 w/enhanced validation) at Atlas Antibodies |
| Documents & Links for Anti ACKR2 pAb (ATL-HPA013819 w/enhanced validation) | |
| Datasheet | Anti ACKR2 pAb (ATL-HPA013819 w/enhanced validation) Datasheet (External Link) |
| Vendor Page | Anti ACKR2 pAb (ATL-HPA013819 w/enhanced validation) |
| Citations for Anti ACKR2 pAb (ATL-HPA013819 w/enhanced validation) – 1 Found |
| Baldwin, Helen M; Singh, Mark D; Codullo, Veronica; King, Vicky; Wilson, Hilary; McInnes, Iain; Graham, Gerard J. Elevated ACKR2 expression is a common feature of inflammatory arthropathies. Rheumatology (Oxford, England). 2017;56(9):1607-1617. PubMed |