Anti ACKR1 pAb (ATL-HPA017672 w/enhanced validation)

Atlas Antibodies

SKU: ATL-HPA017672-25

• 

Protein Description: atypical chemokine receptor 1 (Duffy blood group)
Gene Name: ACKR1
Alternative Gene Name: CCBP1, CD234, DARC, Dfy, FY, GPD
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000037872: 45%, ENSRNOG00000057569: 28%
Entrez Gene ID: 2532
Uniprot ID: Q16570
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: GNCLHRAELSPSTENSSQLDFEDVWNSSYGVNDSFPDGDYGANLEAAAPCHSCNLLDDS
• Gene Sequence: GNCLHRAELSPSTENSSQLDFEDVWNSSYGVNDSFPDGDYGANLEAAAPCHSCNLLDDS
• Gene ID - Mouse: ENSMUSG00000037872
• Gene ID - Rat: ENSRNOG00000057569
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.