Anti ACIN1 pAb (ATL-HPA000657)

Atlas Antibodies

SKU: ATL-HPA000657-25

• 
• 
• 

Protein Description: apoptotic chromatin condensation inducer 1
Gene Name: ACIN1
Alternative Gene Name: ACINUS, fSAP152, KIAA0670
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000022185: 93%, ENSRNOG00000013533: 95%
Entrez Gene ID: 22985
Uniprot ID: Q9UKV3
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, ICC, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: QEEPPAKLLDDLFRKTKAAPCIYWLPLTDSQIVQKEAERAERAKEREKRRKEQEEEEQKEREKEAERERNRQLEREKRREHSRERDRERERERERDRGDRDRDRERDRERGRERDRRDTKRHSRSRSRSTPV
• Gene Sequence: QEEPPAKLLDDLFRKTKAAPCIYWLPLTDSQIVQKEAERAERAKEREKRRKEQEEEEQKEREKEAERERNRQLEREKRREHSRERDRERERERERDRGDRDRDRERDRERGRERDRRDTKRHSRSRSRSTPV
• Gene ID - Mouse: ENSMUSG00000022185
• Gene ID - Rat: ENSRNOG00000013533
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.