Anti ACHE pAb (ATL-HPA027098)

Atlas Antibodies

Catalog No.:
ATL-HPA027098-25
Shipping:
Calculated at Checkout
$423.00
Adding to cart… The item has been added
Protein Description: acetylcholinesterase (Yt blood group)
Gene Name: ACHE
Alternative Gene Name: YT
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000023328: 91%, ENSRNOG00000050841: 89%
Entrez Gene ID: 43
Uniprot ID: P22303
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen RGIRLKTPGGPVSAFLGIPFAEPPMGPRRFLPPEPKQPWSGVVDATTFQSVCYQYVDTLYPGFEGTEMWNPNRE
Gene Sequence RGIRLKTPGGPVSAFLGIPFAEPPMGPRRFLPPEPKQPWSGVVDATTFQSVCYQYVDTLYPGFEGTEMWNPNRE
Gene ID - Mouse ENSMUSG00000023328
Gene ID - Rat ENSRNOG00000050841
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti ACHE pAb (ATL-HPA027098)
Datasheet Anti ACHE pAb (ATL-HPA027098) Datasheet (External Link)
Vendor Page Anti ACHE pAb (ATL-HPA027098) at Atlas Antibodies

Documents & Links for Anti ACHE pAb (ATL-HPA027098)
Datasheet Anti ACHE pAb (ATL-HPA027098) Datasheet (External Link)
Vendor Page Anti ACHE pAb (ATL-HPA027098)