Anti ACER3 pAb (ATL-HPA070087)

Atlas Antibodies

Catalog No.: ATL-HPA070087-25

Protein Description: alkaline ceramidase 3
Gene Name: ACER3
Alternative Gene Name: APHC, FLJ11238, PHCA
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000030760: 82%, ENSRNOG00000036866: 82%
Entrez Gene ID: 55331
Uniprot ID: Q9NUN7
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: DREGYWGPTTSTLDWCEENYSVTWYIAEFWNTVSNLIMIIPPMFGAVQSVRDGLEKR
• Gene Sequence: DREGYWGPTTSTLDWCEENYSVTWYIAEFWNTVSNLIMIIPPMFGAVQSVRDGLEKR
• Gene ID - Mouse: ENSMUSG00000030760
• Gene ID - Rat: ENSRNOG00000036866
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.