Anti ACER3 pAb (ATL-HPA070087)

Atlas Antibodies

Catalog No.:
ATL-HPA070087-25
Shipping:
Calculated at Checkout
$478.00
Adding to cart… The item has been added
Protein Description: alkaline ceramidase 3
Gene Name: ACER3
Alternative Gene Name: APHC, FLJ11238, PHCA
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000030760: 82%, ENSRNOG00000036866: 82%
Entrez Gene ID: 55331
Uniprot ID: Q9NUN7
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen DREGYWGPTTSTLDWCEENYSVTWYIAEFWNTVSNLIMIIPPMFGAVQSVRDGLEKR
Gene Sequence DREGYWGPTTSTLDWCEENYSVTWYIAEFWNTVSNLIMIIPPMFGAVQSVRDGLEKR
Gene ID - Mouse ENSMUSG00000030760
Gene ID - Rat ENSRNOG00000036866
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti ACER3 pAb (ATL-HPA070087)
Datasheet Anti ACER3 pAb (ATL-HPA070087) Datasheet (External Link)
Vendor Page Anti ACER3 pAb (ATL-HPA070087) at Atlas Antibodies

Documents & Links for Anti ACER3 pAb (ATL-HPA070087)
Datasheet Anti ACER3 pAb (ATL-HPA070087) Datasheet (External Link)
Vendor Page Anti ACER3 pAb (ATL-HPA070087)