Anti ACE pAb (ATL-HPA069790)

Atlas Antibodies

Catalog No.: ATL-HPA069790-25

Protein Description: angiotensin I converting enzyme
Gene Name: ACE
Alternative Gene Name: ACE1, CD143, DCP1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000020681: 81%, ENSRNOG00000062101: 83%
Entrez Gene ID: 1636
Uniprot ID: P12821
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: KTATCWSLDPDLTNILASSRSYAMLLFAWEGWHNAAGIPLKPLYEDFTALSNEAYKQDGFTDTGAYWRSWYNSPTFEDDLEHLYQQ
• Gene Sequence: KTATCWSLDPDLTNILASSRSYAMLLFAWEGWHNAAGIPLKPLYEDFTALSNEAYKQDGFTDTGAYWRSWYNSPTFEDDLEHLYQQ
• Gene ID - Mouse: ENSMUSG00000020681
• Gene ID - Rat: ENSRNOG00000062101
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.