Anti ACE pAb (ATL-HPA069790)

Atlas Antibodies

Catalog No.:
ATL-HPA069790-25
Shipping:
Calculated at Checkout
$328.00
Adding to cart… The item has been added
Protein Description: angiotensin I converting enzyme
Gene Name: ACE
Alternative Gene Name: ACE1, CD143, DCP1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000020681: 81%, ENSRNOG00000062101: 83%
Entrez Gene ID: 1636
Uniprot ID: P12821
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen KTATCWSLDPDLTNILASSRSYAMLLFAWEGWHNAAGIPLKPLYEDFTALSNEAYKQDGFTDTGAYWRSWYNSPTFEDDLEHLYQQ
Gene Sequence KTATCWSLDPDLTNILASSRSYAMLLFAWEGWHNAAGIPLKPLYEDFTALSNEAYKQDGFTDTGAYWRSWYNSPTFEDDLEHLYQQ
Gene ID - Mouse ENSMUSG00000020681
Gene ID - Rat ENSRNOG00000062101
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti ACE pAb (ATL-HPA069790)
Datasheet Anti ACE pAb (ATL-HPA069790) Datasheet (External Link)
Vendor Page Anti ACE pAb (ATL-HPA069790) at Atlas Antibodies

Documents & Links for Anti ACE pAb (ATL-HPA069790)
Datasheet Anti ACE pAb (ATL-HPA069790) Datasheet (External Link)
Vendor Page Anti ACE pAb (ATL-HPA069790)