Anti ACCS pAb (ATL-HPA018873)
Atlas Antibodies
- Catalog No.:
- ATL-HPA018873-25
- Shipping:
- Calculated at Checkout
$447.00
Gene Name: ACCS
Alternative Gene Name: ACS, PHACS
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000040272: 92%, ENSRNOG00000009199: 91%
Entrez Gene ID: 84680
Uniprot ID: Q96QU6
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | WB, ICC, IHC |
Reactivity | Human, Mouse, Rat |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | NHARLKAAHTYVSEELRALGIPFLSRGAGFFIWVDLRKYLPKGTFEEEMLLWRRFLDNKVLLSFGKAFECKEPG |
Gene Sequence | NHARLKAAHTYVSEELRALGIPFLSRGAGFFIWVDLRKYLPKGTFEEEMLLWRRFLDNKVLLSFGKAFECKEPG |
Gene ID - Mouse | ENSMUSG00000040272 |
Gene ID - Rat | ENSRNOG00000009199 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links for Anti ACCS pAb (ATL-HPA018873) | |
Datasheet | Anti ACCS pAb (ATL-HPA018873) Datasheet (External Link) |
Vendor Page | Anti ACCS pAb (ATL-HPA018873) at Atlas Antibodies |
Documents & Links for Anti ACCS pAb (ATL-HPA018873) | |
Datasheet | Anti ACCS pAb (ATL-HPA018873) Datasheet (External Link) |
Vendor Page | Anti ACCS pAb (ATL-HPA018873) |