Anti ACCS pAb (ATL-HPA018873)

Atlas Antibodies

SKU: ATL-HPA018873-25

• 
• 
• 

Protein Description: 1-aminocyclopropane-1-carboxylate synthase homolog (Arabidopsis)(non-functional)
Gene Name: ACCS
Alternative Gene Name: ACS, PHACS
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000040272: 92%, ENSRNOG00000009199: 91%
Entrez Gene ID: 84680
Uniprot ID: Q96QU6
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, ICC, IHC
• Reactivity: Human, Mouse, Rat
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: NHARLKAAHTYVSEELRALGIPFLSRGAGFFIWVDLRKYLPKGTFEEEMLLWRRFLDNKVLLSFGKAFECKEPG
• Gene Sequence: NHARLKAAHTYVSEELRALGIPFLSRGAGFFIWVDLRKYLPKGTFEEEMLLWRRFLDNKVLLSFGKAFECKEPG
• Gene ID - Mouse: ENSMUSG00000040272
• Gene ID - Rat: ENSRNOG00000009199
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.