Anti ACBD6 pAb (ATL-HPA028179)

Atlas Antibodies

Catalog No.: ATL-HPA028179-25

Protein Description: acyl-CoA binding domain containing 6
Gene Name: ACBD6
Alternative Gene Name: MGC2404
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000033701: 89%, ENSRNOG00000003550: 89%
Entrez Gene ID: 84320
Uniprot ID: Q9BR61
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: EGRALLHWACDRGHKELVTVLLQHRADINCQDNEGQTALHYASACEFLDIVELLLQSGADPTLRDQDGCLPEEVTGCKTVSLVLQRHTTGKA
• Gene Sequence: EGRALLHWACDRGHKELVTVLLQHRADINCQDNEGQTALHYASACEFLDIVELLLQSGADPTLRDQDGCLPEEVTGCKTVSLVLQRHTTGKA
• Gene ID - Mouse: ENSMUSG00000033701
• Gene ID - Rat: ENSRNOG00000003550
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.