Anti ACBD6 pAb (ATL-HPA028179)

Atlas Antibodies

Catalog No.:
ATL-HPA028179-25
Shipping:
Calculated at Checkout
$303.00
Adding to cart… The item has been added
Protein Description: acyl-CoA binding domain containing 6
Gene Name: ACBD6
Alternative Gene Name: MGC2404
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000033701: 89%, ENSRNOG00000003550: 89%
Entrez Gene ID: 84320
Uniprot ID: Q9BR61
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen EGRALLHWACDRGHKELVTVLLQHRADINCQDNEGQTALHYASACEFLDIVELLLQSGADPTLRDQDGCLPEEVTGCKTVSLVLQRHTTGKA
Gene Sequence EGRALLHWACDRGHKELVTVLLQHRADINCQDNEGQTALHYASACEFLDIVELLLQSGADPTLRDQDGCLPEEVTGCKTVSLVLQRHTTGKA
Gene ID - Mouse ENSMUSG00000033701
Gene ID - Rat ENSRNOG00000003550
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti ACBD6 pAb (ATL-HPA028179)
Datasheet Anti ACBD6 pAb (ATL-HPA028179) Datasheet (External Link)
Vendor Page Anti ACBD6 pAb (ATL-HPA028179) at Atlas Antibodies

Documents & Links for Anti ACBD6 pAb (ATL-HPA028179)
Datasheet Anti ACBD6 pAb (ATL-HPA028179) Datasheet (External Link)
Vendor Page Anti ACBD6 pAb (ATL-HPA028179)