Anti ACBD5 pAb (ATL-HPA012145 w/enhanced validation)

Atlas Antibodies

Catalog No.:
ATL-HPA012145-25
Shipping:
Calculated at Checkout
$303.00
Adding to cart… The item has been added
Protein Description: acyl-CoA binding domain containing 5
Gene Name: ACBD5
Alternative Gene Name: DKFZp434A2417, KIAA1996
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000026781: 63%, ENSRNOG00000046845: 58%
Entrez Gene ID: 91452
Uniprot ID: Q5T8D3
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, ICC, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen AQEEVKGAEQSDNDKKMMKKSADHKNLEVIVTNGYDKDGFVQDIQNDIHASSSLNGRSTEEVKPIDENLGQTGKSAVCIHQDINDDHVEDVTGIQHLTSDSDSEVYCDSMEQFGQEESLDSFTSNNGPFQYYLGGHSSQPM
Gene Sequence AQEEVKGAEQSDNDKKMMKKSADHKNLEVIVTNGYDKDGFVQDIQNDIHASSSLNGRSTEEVKPIDENLGQTGKSAVCIHQDINDDHVEDVTGIQHLTSDSDSEVYCDSMEQFGQEESLDSFTSNNGPFQYYLGGHSSQPM
Gene ID - Mouse ENSMUSG00000026781
Gene ID - Rat ENSRNOG00000046845
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti ACBD5 pAb (ATL-HPA012145 w/enhanced validation)
Datasheet Anti ACBD5 pAb (ATL-HPA012145 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti ACBD5 pAb (ATL-HPA012145 w/enhanced validation) at Atlas Antibodies

Documents & Links for Anti ACBD5 pAb (ATL-HPA012145 w/enhanced validation)
Datasheet Anti ACBD5 pAb (ATL-HPA012145 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti ACBD5 pAb (ATL-HPA012145 w/enhanced validation)
Citations for Anti ACBD5 pAb (ATL-HPA012145 w/enhanced validation) – 7 Found
Wang, Yunhong; Metz, Jeremy; Costello, Joseph L; Passmore, Josiah; Schrader, Michael; Schultz, Christian; Islinger, Markus. Intracellular redistribution of neuronal peroxisomes in response to ACBD5 expression. Plos One. 13(12):e0209507.  PubMed
Bishop, Alexa; Kamoshita, Maki; Passmore, Josiah B; Hacker, Christian; Schrader, Tina A; Waterham, Hans R; Costello, Joseph L; Schrader, Michael. Fluorescent tools to analyse peroxisome-ER interactions in mammalian cells. Contact (Thousand Oaks (Ventura County, Calif.)). 2019;2( 31198905)  PubMed
Chang, Chi-Lun; Weigel, Aubrey V; Ioannou, Maria S; Pasolli, H Amalia; Xu, C Shan; Peale, David R; Shtengel, Gleb; Freeman, Melanie; Hess, Harald F; Blackstone, Craig; Lippincott-Schwartz, Jennifer. Spastin tethers lipid droplets to peroxisomes and directs fatty acid trafficking through ESCRT-III. The Journal Of Cell Biology. 2019;218(8):2583-2599.  PubMed
Valença, Isabel; Ferreira, Ana Rita; Correia, Marcelo; Kühl, Sandra; van Roermund, Carlo; Waterham, Hans R; Máximo, Valdemar; Islinger, Markus; Ribeiro, Daniela. Prostate Cancer Proliferation Is Affected by the Subcellular Localization of MCT2 and Accompanied by Significant Peroxisomal Alterations. Cancers. 2020;12(11)  PubMed
Klouwer, Femke C C; Falkenberg, Kim D; Ofman, Rob; Koster, Janet; van Gent, Démi; Ferdinandusse, Sacha; Wanders, Ronald J A; Waterham, Hans R. Autophagy Inhibitors Do Not Restore Peroxisomal Functions in Cells With the Most Common Peroxisome Biogenesis Defect. Frontiers In Cell And Developmental Biology. 9( 33869228):661298.  PubMed
Zimmermann, Richard; Lang, Sven; Lerner, Monika; Förster, Friedrich; Nguyen, Duy; Helms, Volkhard; Schrul, Bianca. Quantitative Proteomics and Differential Protein Abundance Analysis after the Depletion of PEX3 from Human Cells Identifies Additional Aspects of Protein Targeting to the ER. International Journal Of Molecular Sciences. 2021;22(23)  PubMed
Cook, Katelyn C; Tsopurashvili, Elene; Needham, Jason M; Thompson, Sunnie R; Cristea, Ileana M. Restructured membrane contacts rewire organelles for human cytomegalovirus infection. Nature Communications. 2022;13(1):4720.  PubMed