Anti ACBD5 pAb (ATL-HPA011861 w/enhanced validation)

Atlas Antibodies

SKU:
ATL-HPA011861-25
  • Immunohistochemistry analysis in human small intestine and pancreas tissues using HPA011861 antibody. Corresponding ACBD5 RNA-seq data are presented for the same tissues.
  • Immunofluorescent staining of human cell line A-431 shows localization to peroxisomes.
  • Western blot analysis in human cell lines A-549 and PC-3 using Anti-ACBD5 antibody. Corresponding ACBD5 RNA-seq data are presented for the same cell lines. Loading control: Anti-PPIB.
Shipping:
Calculated at Checkout
$303.00
Adding to cart… The item has been added
Protein Description: acyl-CoA binding domain containing 5
Gene Name: ACBD5
Alternative Gene Name: DKFZp434A2417, KIAA1996
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000026781: 80%, ENSRNOG00000046845: 81%
Entrez Gene ID: 91452
Uniprot ID: Q5T8D3
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, ICC, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen IQVPPGNGNIGNMQVVAVEGKGEVKHGGEDGRNNSGAPHREKRGGETDEFSNVRRGRGHRMQHLSEGTKGRQVGSGGDGERWGSDRGSRGSLNEQIALVLMRLQEDMQNVLQRLQKLETLTALQAKSSTSTLQTAPQPTSQRPSWWPF
Gene Sequence IQVPPGNGNIGNMQVVAVEGKGEVKHGGEDGRNNSGAPHREKRGGETDEFSNVRRGRGHRMQHLSEGTKGRQVGSGGDGERWGSDRGSRGSLNEQIALVLMRLQEDMQNVLQRLQKLETLTALQAKSSTSTLQTAPQPTSQRPSWWPF
Gene ID - Mouse ENSMUSG00000026781
Gene ID - Rat ENSRNOG00000046845
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.


Documents & Links for Anti ACBD5 pAb (ATL-HPA011861 w/enhanced validation)
Datasheet Anti ACBD5 pAb (ATL-HPA011861 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti ACBD5 pAb (ATL-HPA011861 w/enhanced validation) at Atlas Antibodies

Documents & Links for Anti ACBD5 pAb (ATL-HPA011861 w/enhanced validation)
Datasheet Anti ACBD5 pAb (ATL-HPA011861 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti ACBD5 pAb (ATL-HPA011861 w/enhanced validation)



Citations for Anti ACBD5 pAb (ATL-HPA011861 w/enhanced validation) – 1 Found
Nazarko, Taras Y; Ozeki, Katharine; Till, Andreas; Ramakrishnan, Geetha; Lotfi, Pouya; Yan, Mingda; Subramani, Suresh. Peroxisomal Atg37 binds Atg30 or palmitoyl-CoA to regulate phagophore formation during pexophagy. The Journal Of Cell Biology. 2014;204(4):541-57.  PubMed