Anti ACBD4 pAb (ATL-HPA051772)

Atlas Antibodies

Catalog No.:
ATL-HPA051772-25
Shipping:
Calculated at Checkout
$478.00
Adding to cart… The item has been added
Protein Description: acyl-CoA binding domain containing 4
Gene Name: ACBD4
Alternative Gene Name: FLJ13322
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000056938: 82%, ENSRNOG00000003108: 87%
Entrez Gene ID: 79777
Uniprot ID: Q8NC06
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen SAYITEMKLVAQKVIDTVPLGEVAEDMFGYFEPLYQVIPDMPRPPETFLRRVTGWKEQVVNGDVGAVSEPPCLPKEPA
Gene Sequence SAYITEMKLVAQKVIDTVPLGEVAEDMFGYFEPLYQVIPDMPRPPETFLRRVTGWKEQVVNGDVGAVSEPPCLPKEPA
Gene ID - Mouse ENSMUSG00000056938
Gene ID - Rat ENSRNOG00000003108
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti ACBD4 pAb (ATL-HPA051772)
Datasheet Anti ACBD4 pAb (ATL-HPA051772) Datasheet (External Link)
Vendor Page Anti ACBD4 pAb (ATL-HPA051772) at Atlas Antibodies

Documents & Links for Anti ACBD4 pAb (ATL-HPA051772)
Datasheet Anti ACBD4 pAb (ATL-HPA051772) Datasheet (External Link)
Vendor Page Anti ACBD4 pAb (ATL-HPA051772)