Anti ACAT2 pAb (ATL-HPA025811 w/enhanced validation)

Atlas Antibodies

Catalog No.:
ATL-HPA025811-100
Shipping:
Calculated at Checkout
$596.00
Adding to cart… The item has been added
Protein Description: acetyl-CoA acetyltransferase 2
Gene Name: ACAT2
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000062480: 83%, ENSRNOG00000019189: 84%
Entrez Gene ID: 39
Uniprot ID: Q9BWD1
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen IIGSFNGALAAVPVQDLGSTVIKEVLKRATVAPEDVSEVIFGHVLAAGCGQNPVRQASVGAGIPYSVPAW
Gene Sequence IIGSFNGALAAVPVQDLGSTVIKEVLKRATVAPEDVSEVIFGHVLAAGCGQNPVRQASVGAGIPYSVPAW
Gene ID - Mouse ENSMUSG00000062480
Gene ID - Rat ENSRNOG00000019189
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti ACAT2 pAb (ATL-HPA025811 w/enhanced validation)
Datasheet Anti ACAT2 pAb (ATL-HPA025811 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti ACAT2 pAb (ATL-HPA025811 w/enhanced validation) at Atlas Antibodies

Documents & Links for Anti ACAT2 pAb (ATL-HPA025811 w/enhanced validation)
Datasheet Anti ACAT2 pAb (ATL-HPA025811 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti ACAT2 pAb (ATL-HPA025811 w/enhanced validation)