Anti ACAT2 pAb (ATL-HPA025736 w/enhanced validation)

Atlas Antibodies

Catalog No.: ATL-HPA025736-25

Protein Description: acetyl-CoA acetyltransferase 2
Gene Name: ACAT2
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000023832: 84%, ENSRNOG00000019189: 84%
Entrez Gene ID: 39
Uniprot ID: Q9BWD1
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: LVSTRKGLIEVKTDEFPRHGSNIEAMSKLKPYFLTDGTGTVTPANASGINDGAAAVVLMKKSEADKRGLT
• Gene Sequence: LVSTRKGLIEVKTDEFPRHGSNIEAMSKLKPYFLTDGTGTVTPANASGINDGAAAVVLMKKSEADKRGLT
• Gene ID - Mouse: ENSMUSG00000023832
• Gene ID - Rat: ENSRNOG00000019189
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Citations for Anti ACAT2 pAb (ATL-HPA025736 w/enhanced validation) – 1 Found

Martinez-Outschoorn, Ubaldo E; Lin, Zhao; Whitaker-Menezes, Diana; Howell, Anthony; Sotgia, Federica; Lisanti, Michael P. Ketone body utilization drives tumor growth and metastasis. Cell Cycle (Georgetown, Tex.). 2012;11(21):3964-71.