Anti ACAT1 pAb (ATL-HPA007569 w/enhanced validation)

Atlas Antibodies

SKU: ATL-HPA007569-25

• 
• 
• 

Protein Description: acetyl-CoA acetyltransferase 1
Gene Name: ACAT1
Alternative Gene Name: ACAT, THIL
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000032047: 80%, ENSRNOG00000007862: 81%
Entrez Gene ID: 38
Uniprot ID: P24752
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, ICC, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: NEQDAYAINSYTRSKAAWEAGKFGNEVIPVTVTVKGQPDVVVKEDEEYKRVDFSKVPKLKTVFQKENGTVTAANASTLNDGAAALVLMTADAAKRLNVTPLARIVAFADAAVEPIDFPIAPVYAASMV
• Gene Sequence: NEQDAYAINSYTRSKAAWEAGKFGNEVIPVTVTVKGQPDVVVKEDEEYKRVDFSKVPKLKTVFQKENGTVTAANASTLNDGAAALVLMTADAAKRLNVTPLARIVAFADAAVEPIDFPIAPVYAASMV
• Gene ID - Mouse: ENSMUSG00000032047
• Gene ID - Rat: ENSRNOG00000007862
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Citations for Anti ACAT1 pAb (ATL-HPA007569 w/enhanced validation) – 5 Found

Stadler, Charlotte; Hjelmare, Martin; Neumann, Beate; Jonasson, Kalle; Pepperkok, Rainer; Uhlén, Mathias; Lundberg, Emma. Systematic validation of antibody binding and protein subcellular localization using siRNA and confocal microscopy. Journal Of Proteomics. 2012;75(7):2236-51. 

Martinez-Outschoorn, Ubaldo E; Lin, Zhao; Whitaker-Menezes, Diana; Howell, Anthony; Lisanti, Michael P; Sotgia, Federica. Ketone bodies and two-compartment tumor metabolism: stromal ketone production fuels mitochondrial biogenesis in epithelial cancer cells. Cell Cycle (Georgetown, Tex.). 2012;11(21):3956-63. 

Martinez-Outschoorn, Ubaldo E; Lin, Zhao; Whitaker-Menezes, Diana; Howell, Anthony; Sotgia, Federica; Lisanti, Michael P. Ketone body utilization drives tumor growth and metastasis. Cell Cycle (Georgetown, Tex.). 2012;11(21):3964-71. 

Chang, Howard T; Olson, Lawrence Karl; Schwartz, Kenneth A. Ketolytic and glycolytic enzymatic expression profiles in malignant gliomas: implication for ketogenic diet therapy. Nutrition & Metabolism. 2013;10(1):47. 

Andersson, Sandra; Konrad, Anna; Ashok, Nikhil; Pontén, Fredrik; Hober, Sophia; Asplund, Anna. Antibodies biotinylated using a synthetic Z-domain from protein A provide stringent in situ protein detection. The Journal Of Histochemistry And Cytochemistry : Official Journal Of The Histochemistry Society. 2013;61(11):773-84.