Anti ACAT1 pAb (ATL-HPA007569 w/enhanced validation)
Atlas Antibodies
- Catalog No.:
- ATL-HPA007569-25
- Shipping:
- Calculated at Checkout
$395.00
Gene Name: ACAT1
Alternative Gene Name: ACAT, THIL
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000032047: 80%, ENSRNOG00000007862: 81%
Entrez Gene ID: 38
Uniprot ID: P24752
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | WB, ICC, IHC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | NEQDAYAINSYTRSKAAWEAGKFGNEVIPVTVTVKGQPDVVVKEDEEYKRVDFSKVPKLKTVFQKENGTVTAANASTLNDGAAALVLMTADAAKRLNVTPLARIVAFADAAVEPIDFPIAPVYAASMV |
Gene Sequence | NEQDAYAINSYTRSKAAWEAGKFGNEVIPVTVTVKGQPDVVVKEDEEYKRVDFSKVPKLKTVFQKENGTVTAANASTLNDGAAALVLMTADAAKRLNVTPLARIVAFADAAVEPIDFPIAPVYAASMV |
Gene ID - Mouse | ENSMUSG00000032047 |
Gene ID - Rat | ENSRNOG00000007862 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links for Anti ACAT1 pAb (ATL-HPA007569 w/enhanced validation) | |
Datasheet | Anti ACAT1 pAb (ATL-HPA007569 w/enhanced validation) Datasheet (External Link) |
Vendor Page | Anti ACAT1 pAb (ATL-HPA007569 w/enhanced validation) at Atlas Antibodies |
Documents & Links for Anti ACAT1 pAb (ATL-HPA007569 w/enhanced validation) | |
Datasheet | Anti ACAT1 pAb (ATL-HPA007569 w/enhanced validation) Datasheet (External Link) |
Vendor Page | Anti ACAT1 pAb (ATL-HPA007569 w/enhanced validation) |
Citations for Anti ACAT1 pAb (ATL-HPA007569 w/enhanced validation) – 5 Found |
Stadler, Charlotte; Hjelmare, Martin; Neumann, Beate; Jonasson, Kalle; Pepperkok, Rainer; Uhlén, Mathias; Lundberg, Emma. Systematic validation of antibody binding and protein subcellular localization using siRNA and confocal microscopy. Journal Of Proteomics. 2012;75(7):2236-51. PubMed |
Martinez-Outschoorn, Ubaldo E; Lin, Zhao; Whitaker-Menezes, Diana; Howell, Anthony; Lisanti, Michael P; Sotgia, Federica. Ketone bodies and two-compartment tumor metabolism: stromal ketone production fuels mitochondrial biogenesis in epithelial cancer cells. Cell Cycle (Georgetown, Tex.). 2012;11(21):3956-63. PubMed |
Martinez-Outschoorn, Ubaldo E; Lin, Zhao; Whitaker-Menezes, Diana; Howell, Anthony; Sotgia, Federica; Lisanti, Michael P. Ketone body utilization drives tumor growth and metastasis. Cell Cycle (Georgetown, Tex.). 2012;11(21):3964-71. PubMed |
Chang, Howard T; Olson, Lawrence Karl; Schwartz, Kenneth A. Ketolytic and glycolytic enzymatic expression profiles in malignant gliomas: implication for ketogenic diet therapy. Nutrition & Metabolism. 2013;10(1):47. PubMed |
Andersson, Sandra; Konrad, Anna; Ashok, Nikhil; Pontén, Fredrik; Hober, Sophia; Asplund, Anna. Antibodies biotinylated using a synthetic Z-domain from protein A provide stringent in situ protein detection. The Journal Of Histochemistry And Cytochemistry : Official Journal Of The Histochemistry Society. 2013;61(11):773-84. PubMed |