Anti ACAT1 pAb (ATL-HPA004428 w/enhanced validation)
Atlas Antibodies
- SKU:
- ATL-HPA004428-25
- Shipping:
- Calculated at Checkout
$395.00
Gene Name: ACAT1
Alternative Gene Name: ACAT, THIL
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000032047: 92%, ENSRNOG00000007862: 92%
Entrez Gene ID: 38
Uniprot ID: P24752
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | WB, ICC, IHC |
Reactivity | Human, Mouse, Rat |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | VSATRTPIGSFLGSLSLLPATKLGSIAIQGAIEKAGIPKEEVKEAYMGNVLQGGEGQAPTRQAVLGAGLPISTPCTTINKVCASGMKAIMMASQSLMCGHQDVMVAGGMESMSNVPYVMNRGSTPYGGVKLEDLIVKDGLTD |
Gene Sequence | VSATRTPIGSFLGSLSLLPATKLGSIAIQGAIEKAGIPKEEVKEAYMGNVLQGGEGQAPTRQAVLGAGLPISTPCTTINKVCASGMKAIMMASQSLMCGHQDVMVAGGMESMSNVPYVMNRGSTPYGGVKLEDLIVKDGLTD |
Gene ID - Mouse | ENSMUSG00000032047 |
Gene ID - Rat | ENSRNOG00000007862 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links for Anti ACAT1 pAb (ATL-HPA004428 w/enhanced validation) | |
Datasheet | Anti ACAT1 pAb (ATL-HPA004428 w/enhanced validation) Datasheet (External Link) |
Vendor Page | Anti ACAT1 pAb (ATL-HPA004428 w/enhanced validation) at Atlas Antibodies |
Documents & Links for Anti ACAT1 pAb (ATL-HPA004428 w/enhanced validation) | |
Datasheet | Anti ACAT1 pAb (ATL-HPA004428 w/enhanced validation) Datasheet (External Link) |
Vendor Page | Anti ACAT1 pAb (ATL-HPA004428 w/enhanced validation) |
Citations for Anti ACAT1 pAb (ATL-HPA004428 w/enhanced validation) – 9 Found |
Svensson, Kristoffer; Albert, Verena; Cardel, Bettina; Salatino, Silvia; Handschin, Christoph. Skeletal muscle PGC-1α modulates systemic ketone body homeostasis and ameliorates diabetic hyperketonemia in mice. Faseb Journal : Official Publication Of The Federation Of American Societies For Experimental Biology. 2016;30(5):1976-86. PubMed |
Lu, Yunliang; Zhou, Xiaohui; Zhao, Weilin; Liao, Zhipeng; Li, Bo; Han, Peipei; Yang, Yanping; Zhong, Xuemin; Mo, Yingxi; Li, Ping; Huang, Guangwu; Xiao, Xue; Zhang, Zhe; Zhou, Xiaoying. Epigenetic Inactivation of Acetyl-CoA Acetyltransferase 1 Promotes the Proliferation and Metastasis in Nasopharyngeal Carcinoma by Blocking Ketogenesis. Frontiers In Oncology. 11( 34485115):667673. PubMed |
Stadler, Charlotte; Hjelmare, Martin; Neumann, Beate; Jonasson, Kalle; Pepperkok, Rainer; Uhlén, Mathias; Lundberg, Emma. Systematic validation of antibody binding and protein subcellular localization using siRNA and confocal microscopy. Journal Of Proteomics. 2012;75(7):2236-51. PubMed |
Sanchez-Alvarez, Rosa; Martinez-Outschoorn, Ubaldo E; Lin, Zhao; Lamb, Rebecca; Hulit, James; Howell, Anthony; Sotgia, Federica; Rubin, Emanuel; Lisanti, Michael P. Ethanol exposure induces the cancer-associated fibroblast phenotype and lethal tumor metabolism: implications for breast cancer prevention. Cell Cycle (Georgetown, Tex.). 2013;12(2):289-301. PubMed |
Saadane, Aicha; Mast, Natalia; Dao, Tung; Ahmad, Baseer; Pikuleva, Irina A. Retinal Hypercholesterolemia Triggers Cholesterol Accumulation and Esterification in Photoreceptor Cells. The Journal Of Biological Chemistry. 2016;291(39):20427-39. PubMed |
Schnyder, Svenia; Svensson, Kristoffer; Cardel, Bettina; Handschin, Christoph. Muscle PGC-1α is required for long-term systemic and local adaptations to a ketogenic diet in mice. American Journal Of Physiology. Endocrinology And Metabolism. 2017;312(5):E437-E446. PubMed |
Li, Bo; Liao, Zhipeng; Mo, Yingxi; Zhao, Weilin; Zhou, Xiaohui; Xiao, Xiling; Cui, Wanmeng; Feng, Guofei; Zhong, Suhua; Liang, Yushan; Du, Chunping; Huang, Guangwu; Li, Ping; Xiao, Xue; Zhou, Xiaoying; Wang, Rensheng; Zhang, Zhe. Inactivation of 3-hydroxybutyrate dehydrogenase type 2 promotes proliferation and metastasis of nasopharyngeal carcinoma by iron retention. British Journal Of Cancer. 2020;122(1):102-110. PubMed |
Cui, Wanmeng; Luo, Wenqi; Zhou, Xiaohui; Lu, Yunliang; Xu, Wenqing; Zhong, Suhua; Feng, Guofei; Liang, Yushan; Liang, Libin; Mo, Yingxi; Xiao, Xue; Huang, Guangwu; Matskova, Liudmila; Zhang, Zhe; Li, Ping; Zhou, Xiaoying. Dysregulation of Ketone Body Metabolism Is Associated With Poor Prognosis for Clear Cell Renal Cell Carcinoma Patients. Frontiers In Oncology. 9( 31921677):1422. PubMed |
Labanca, Estefania; Bizzotto, Juan; Sanchis, Pablo; Anselmino, Nicolas; Yang, Jun; Shepherd, Peter D A; Paez, Alejandra; Antico-Arciuch, Valeria; Lage-Vickers, Sofia; Hoang, Anh G; Tang, Ximing; Raso, Maria Gabriela; Titus, Mark; Efstathiou, Eleni; Cotignola, Javier; Araujo, John; Logothetis, Christopher; Vazquez, Elba; Navone, Nora; Gueron, Geraldine. Prostate cancer castrate resistant progression usage of non-canonical androgen receptor signaling and ketone body fuel. Oncogene. 2021;40(44):6284-6298. PubMed |