Anti ACAP3 pAb (ATL-HPA058381)

Atlas Antibodies

Catalog No.:
ATL-HPA058381-25
Shipping:
Calculated at Checkout
$478.00
Adding to cart… The item has been added
Protein Description: ArfGAP with coiled-coil, ankyrin repeat and PH domains 3
Gene Name: ACAP3
Alternative Gene Name: CENTB5, KIAA1716
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000029033: 96%, ENSRNOG00000022307: 96%
Entrez Gene ID: 116983
Uniprot ID: Q96P50
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen LRQAWVQAVQASIASAYRESPDSCYSERLDRTASPSTSSIDSATDTRERGVKGESVL
Gene Sequence LRQAWVQAVQASIASAYRESPDSCYSERLDRTASPSTSSIDSATDTRERGVKGESVL
Gene ID - Mouse ENSMUSG00000029033
Gene ID - Rat ENSRNOG00000022307
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti ACAP3 pAb (ATL-HPA058381)
Datasheet Anti ACAP3 pAb (ATL-HPA058381) Datasheet (External Link)
Vendor Page Anti ACAP3 pAb (ATL-HPA058381) at Atlas Antibodies

Documents & Links for Anti ACAP3 pAb (ATL-HPA058381)
Datasheet Anti ACAP3 pAb (ATL-HPA058381) Datasheet (External Link)
Vendor Page Anti ACAP3 pAb (ATL-HPA058381)