Anti ACAP3 pAb (ATL-HPA049317)
Atlas Antibodies
- Catalog No.:
- ATL-HPA049317-25
- Shipping:
- Calculated at Checkout
$324.00
Gene Name: ACAP3
Alternative Gene Name: CENTB5, KIAA1716
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000029033: 90%, ENSRNOG00000022307: 90%
Entrez Gene ID: 116983
Uniprot ID: Q96P50
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | VKLCSGMVEAGKAYVSTSRLFVSGVRDLSQQCQGDTVISECLQRFADSLQEVVNYHMILFDQAQRSVRQQLQSFVKE |
| Gene Sequence | VKLCSGMVEAGKAYVSTSRLFVSGVRDLSQQCQGDTVISECLQRFADSLQEVVNYHMILFDQAQRSVRQQLQSFVKE |
| Gene ID - Mouse | ENSMUSG00000029033 |
| Gene ID - Rat | ENSRNOG00000022307 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti ACAP3 pAb (ATL-HPA049317) | |
| Datasheet | Anti ACAP3 pAb (ATL-HPA049317) Datasheet (External Link) |
| Vendor Page | Anti ACAP3 pAb (ATL-HPA049317) at Atlas Antibodies |
| Documents & Links for Anti ACAP3 pAb (ATL-HPA049317) | |
| Datasheet | Anti ACAP3 pAb (ATL-HPA049317) Datasheet (External Link) |
| Vendor Page | Anti ACAP3 pAb (ATL-HPA049317) |