Anti ACAP2 pAb (ATL-HPA034807)

Atlas Antibodies

Catalog No.:
ATL-HPA034807-25
Shipping:
Calculated at Checkout
$324.00
Adding to cart… The item has been added
Protein Description: ArfGAP with coiled-coil, ankyrin repeat and PH domains 2
Gene Name: ACAP2
Alternative Gene Name: CENTB2, CNT-B2, KIAA0041
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000049076: 71%, ENSRNOG00000001730: 71%
Entrez Gene ID: 23527
Uniprot ID: Q15057
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen RVYEANVEKMGIKKPQPGQRQEKEAYIRAKYVERKFVDKYSISLSPPEQQKKFVSKSSEEKRLSISKFGPGD
Gene Sequence RVYEANVEKMGIKKPQPGQRQEKEAYIRAKYVERKFVDKYSISLSPPEQQKKFVSKSSEEKRLSISKFGPGD
Gene ID - Mouse ENSMUSG00000049076
Gene ID - Rat ENSRNOG00000001730
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti ACAP2 pAb (ATL-HPA034807)
Datasheet Anti ACAP2 pAb (ATL-HPA034807) Datasheet (External Link)
Vendor Page Anti ACAP2 pAb (ATL-HPA034807) at Atlas Antibodies

Documents & Links for Anti ACAP2 pAb (ATL-HPA034807)
Datasheet Anti ACAP2 pAb (ATL-HPA034807) Datasheet (External Link)
Vendor Page Anti ACAP2 pAb (ATL-HPA034807)