Anti ACAP2 pAb (ATL-HPA034807)
Atlas Antibodies
- Catalog No.:
- ATL-HPA034807-25
- Shipping:
- Calculated at Checkout
$324.00
Gene Name: ACAP2
Alternative Gene Name: CENTB2, CNT-B2, KIAA0041
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000049076: 71%, ENSRNOG00000001730: 71%
Entrez Gene ID: 23527
Uniprot ID: Q15057
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | WB, IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | RVYEANVEKMGIKKPQPGQRQEKEAYIRAKYVERKFVDKYSISLSPPEQQKKFVSKSSEEKRLSISKFGPGD |
| Gene Sequence | RVYEANVEKMGIKKPQPGQRQEKEAYIRAKYVERKFVDKYSISLSPPEQQKKFVSKSSEEKRLSISKFGPGD |
| Gene ID - Mouse | ENSMUSG00000049076 |
| Gene ID - Rat | ENSRNOG00000001730 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti ACAP2 pAb (ATL-HPA034807) | |
| Datasheet | Anti ACAP2 pAb (ATL-HPA034807) Datasheet (External Link) |
| Vendor Page | Anti ACAP2 pAb (ATL-HPA034807) at Atlas Antibodies |
| Documents & Links for Anti ACAP2 pAb (ATL-HPA034807) | |
| Datasheet | Anti ACAP2 pAb (ATL-HPA034807) Datasheet (External Link) |
| Vendor Page | Anti ACAP2 pAb (ATL-HPA034807) |