Anti ACAP2 pAb (ATL-HPA034807)
Atlas Antibodies
- Catalog No.:
- ATL-HPA034807-25
- Shipping:
- Calculated at Checkout
$303.00
Gene Name: ACAP2
Alternative Gene Name: CENTB2, CNT-B2, KIAA0041
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000049076: 71%, ENSRNOG00000001730: 71%
Entrez Gene ID: 23527
Uniprot ID: Q15057
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | WB, IHC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | RVYEANVEKMGIKKPQPGQRQEKEAYIRAKYVERKFVDKYSISLSPPEQQKKFVSKSSEEKRLSISKFGPGD |
Gene Sequence | RVYEANVEKMGIKKPQPGQRQEKEAYIRAKYVERKFVDKYSISLSPPEQQKKFVSKSSEEKRLSISKFGPGD |
Gene ID - Mouse | ENSMUSG00000049076 |
Gene ID - Rat | ENSRNOG00000001730 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links for Anti ACAP2 pAb (ATL-HPA034807) | |
Datasheet | Anti ACAP2 pAb (ATL-HPA034807) Datasheet (External Link) |
Vendor Page | Anti ACAP2 pAb (ATL-HPA034807) at Atlas Antibodies |
Documents & Links for Anti ACAP2 pAb (ATL-HPA034807) | |
Datasheet | Anti ACAP2 pAb (ATL-HPA034807) Datasheet (External Link) |
Vendor Page | Anti ACAP2 pAb (ATL-HPA034807) |