Anti ACAP2 pAb (ATL-HPA034807)

Atlas Antibodies

SKU: ATL-HPA034807-25

• 
• 

Protein Description: ArfGAP with coiled-coil, ankyrin repeat and PH domains 2
Gene Name: ACAP2
Alternative Gene Name: CENTB2, CNT-B2, KIAA0041
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000049076: 71%, ENSRNOG00000001730: 71%
Entrez Gene ID: 23527
Uniprot ID: Q15057
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: RVYEANVEKMGIKKPQPGQRQEKEAYIRAKYVERKFVDKYSISLSPPEQQKKFVSKSSEEKRLSISKFGPGD
• Gene Sequence: RVYEANVEKMGIKKPQPGQRQEKEAYIRAKYVERKFVDKYSISLSPPEQQKKFVSKSSEEKRLSISKFGPGD
• Gene ID - Mouse: ENSMUSG00000049076
• Gene ID - Rat: ENSRNOG00000001730
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.