Anti ACAP1 pAb (ATL-HPA075570)

Atlas Antibodies

Catalog No.:
ATL-HPA075570-25
Shipping:
Calculated at Checkout
$447.00
Adding to cart… The item has been added
Protein Description: ArfGAP with coiled-coil, ankyrin repeat and PH domains 1
Gene Name: ACAP1
Alternative Gene Name: CENTB1, KIAA0050
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000001588: 90%, ENSRNOG00000015674: 89%
Entrez Gene ID: 9744
Uniprot ID: Q15027
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen QGHEELSRLSQYRKELGAQLHQLVLNSAREKRDMEQRHVLLKQKELGGEEPEPSLREGPGGLVMEGHLFK
Gene Sequence QGHEELSRLSQYRKELGAQLHQLVLNSAREKRDMEQRHVLLKQKELGGEEPEPSLREGPGGLVMEGHLFK
Gene ID - Mouse ENSMUSG00000001588
Gene ID - Rat ENSRNOG00000015674
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti ACAP1 pAb (ATL-HPA075570)
Datasheet Anti ACAP1 pAb (ATL-HPA075570) Datasheet (External Link)
Vendor Page Anti ACAP1 pAb (ATL-HPA075570) at Atlas Antibodies

Documents & Links for Anti ACAP1 pAb (ATL-HPA075570)
Datasheet Anti ACAP1 pAb (ATL-HPA075570) Datasheet (External Link)
Vendor Page Anti ACAP1 pAb (ATL-HPA075570)