Anti ACADVL pAb (ATL-HPA019006 w/enhanced validation)

Atlas Antibodies

SKU:
ATL-HPA019006-25
  • Immunohistochemistry analysis in human duodenum and lymph node tissues using HPA019006 antibody. Corresponding ACADVL RNA-seq data are presented for the same tissues.
  • Immunofluorescent staining of human cell line A549 shows localization to nucleus, nucleoli & mitochondria.
  • Western blot analysis using Anti-ACADVL antibody HPA019006 (A) shows similar pattern to independent antibody HPA020595 (B).
Shipping:
Calculated at Checkout
$303.00
Adding to cart… The item has been added
Protein Description: acyl-CoA dehydrogenase, very long chain
Gene Name: ACADVL
Alternative Gene Name: ACAD6, LCACD, VLCAD
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000018574: 85%, ENSRNOG00000018114: 86%
Entrez Gene ID: 37
Uniprot ID: P49748
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, ICC, IHC
Reactivity Human, Mouse, Rat
Clonality Polyclonal
Host Rabbit
Immunogen KLIKHKKGIVNEQFLLQRLADGAIDLYAMVVVLSRASRSLSEGHPTAQHEKMLCDTWCIEAAARIREGMAALQSDPWQQELYRNFKSISKALVERGGVVTSNPLGF
Gene Sequence KLIKHKKGIVNEQFLLQRLADGAIDLYAMVVVLSRASRSLSEGHPTAQHEKMLCDTWCIEAAARIREGMAALQSDPWQQELYRNFKSISKALVERGGVVTSNPLGF
Gene ID - Mouse ENSMUSG00000018574
Gene ID - Rat ENSRNOG00000018114
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.



Documents & Links for Anti ACADVL pAb (ATL-HPA019006 w/enhanced validation)
Datasheet Anti ACADVL pAb (ATL-HPA019006 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti ACADVL pAb (ATL-HPA019006 w/enhanced validation)