Anti ACADSB pAb (ATL-HPA041458 w/enhanced validation)

Atlas Antibodies

SKU:
ATL-HPA041458-100
  • Immunohistochemistry analysis in human liver and placenta tissues using Anti-ACADSB antibody. Corresponding ACADSB RNA-seq data are presented for the same tissues.
  • Immunofluorescent staining of human cell line U-251 MG shows localization to mitochondria.
  • Western blot analysis in human cell lines A-431 and HeLa using Anti-ACADSB antibody. Corresponding ACADSB RNA-seq data are presented for the same cell lines. Loading control: Anti-PPIB.
Shipping:
Calculated at Checkout
$596.00
Adding to cart… The item has been added
Protein Description: acyl-CoA dehydrogenase, short/branched chain
Gene Name: ACADSB
Alternative Gene Name: ACAD7, SBCAD
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000030861: 95%, ENSRNOG00000020624: 92%
Entrez Gene ID: 36
Uniprot ID: P45954
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, ICC, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen EASMAKYYASEIAGQTTSKCIEWMGGVGYTKDYPVEKYFRDAKIGTIYEGASNIQLNTIAKHIDAE
Gene Sequence EASMAKYYASEIAGQTTSKCIEWMGGVGYTKDYPVEKYFRDAKIGTIYEGASNIQLNTIAKHIDAE
Gene ID - Mouse ENSMUSG00000030861
Gene ID - Rat ENSRNOG00000020624
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.



Documents & Links for Anti ACADSB pAb (ATL-HPA041458 w/enhanced validation)
Datasheet Anti ACADSB pAb (ATL-HPA041458 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti ACADSB pAb (ATL-HPA041458 w/enhanced validation)