Anti ACADS pAb (ATL-HPA022271 w/enhanced validation)

Atlas Antibodies

Catalog No.:
ATL-HPA022271-25
Shipping:
Calculated at Checkout
$324.00
Adding to cart… The item has been added
Protein Description: acyl-CoA dehydrogenase, C-2 to C-3 short chain
Gene Name: ACADS
Alternative Gene Name: ACAD3, SCAD
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000029545: 88%, ENSRNOG00000001177: 89%
Entrez Gene ID: 35
Uniprot ID: P16219
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, ICC, IHC
Reactivity Human, Mouse, Rat
Clonality Polyclonal
Host Rabbit
Immunogen ELPETHQMLLQTCRDFAEKELFPIAAQVDKEHLFPAAQVKKMGGLGLLAMDVPEELGGAGLDYLAYAIAMEEISRGCASTGVIMSVNNSLYLGPILKFGSKEQKQAWVTPFTSGDKIGCFALSEPGNGS
Gene Sequence ELPETHQMLLQTCRDFAEKELFPIAAQVDKEHLFPAAQVKKMGGLGLLAMDVPEELGGAGLDYLAYAIAMEEISRGCASTGVIMSVNNSLYLGPILKFGSKEQKQAWVTPFTSGDKIGCFALSEPGNGS
Gene ID - Mouse ENSMUSG00000029545
Gene ID - Rat ENSRNOG00000001177
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti ACADS pAb (ATL-HPA022271 w/enhanced validation)
Datasheet Anti ACADS pAb (ATL-HPA022271 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti ACADS pAb (ATL-HPA022271 w/enhanced validation) at Atlas Antibodies

Documents & Links for Anti ACADS pAb (ATL-HPA022271 w/enhanced validation)
Datasheet Anti ACADS pAb (ATL-HPA022271 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti ACADS pAb (ATL-HPA022271 w/enhanced validation)
Citations for Anti ACADS pAb (ATL-HPA022271 w/enhanced validation) – 1 Found
Ericksen, Russell E; Lim, Siew Lan; McDonnell, Eoin; Shuen, Wai Ho; Vadiveloo, Maya; White, Phillip J; Ding, Zhaobing; Kwok, Royston; Lee, Philip; Radda, George K; Toh, Han Chong; Hirschey, Matthew D; Han, Weiping. Loss of BCAA Catabolism during Carcinogenesis Enhances mTORC1 Activity and Promotes Tumor Development and Progression. Cell Metabolism. 2019;29(5):1151-1165.e6.  PubMed