Anti ACAD8 pAb (ATL-HPA040689)

Atlas Antibodies

Catalog No.:
ATL-HPA040689-25
Shipping:
Calculated at Checkout
$324.00
Adding to cart… The item has been added
Protein Description: acyl-CoA dehydrogenase family, member 8
Gene Name: ACAD8
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000031969: 97%, ENSRNOG00000048164: 96%
Entrez Gene ID: 27034
Uniprot ID: Q9UKU7
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen ELFPVDVMRKAAQLGFGGVYIQTDVGGSGLSRLDTSVIFEALATGCTSTTAYISIHNMCAWMIDSFGNEEQRHKFCPPL
Gene Sequence ELFPVDVMRKAAQLGFGGVYIQTDVGGSGLSRLDTSVIFEALATGCTSTTAYISIHNMCAWMIDSFGNEEQRHKFCPPL
Gene ID - Mouse ENSMUSG00000031969
Gene ID - Rat ENSRNOG00000048164
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti ACAD8 pAb (ATL-HPA040689)
Datasheet Anti ACAD8 pAb (ATL-HPA040689) Datasheet (External Link)
Vendor Page Anti ACAD8 pAb (ATL-HPA040689) at Atlas Antibodies

Documents & Links for Anti ACAD8 pAb (ATL-HPA040689)
Datasheet Anti ACAD8 pAb (ATL-HPA040689) Datasheet (External Link)
Vendor Page Anti ACAD8 pAb (ATL-HPA040689)
Citations for Anti ACAD8 pAb (ATL-HPA040689) – 1 Found
Sinha, Ankit; Huang, Vincent; Livingstone, Julie; Wang, Jenny; Fox, Natalie S; Kurganovs, Natalie; Ignatchenko, Vladimir; Fritsch, Katharina; Donmez, Nilgun; Heisler, Lawrence E; Shiah, Yu-Jia; Yao, Cindy Q; Alfaro, Javier A; Volik, Stas; Lapuk, Anna; Fraser, Michael; Kron, Ken; Murison, Alex; Lupien, Mathieu; Sahinalp, Cenk; Collins, Colin C; Tetu, Bernard; Masoomian, Mehdi; Berman, David M; van der Kwast, Theodorus; Bristow, Robert G; Kislinger, Thomas; Boutros, Paul C. The Proteogenomic Landscape of Curable Prostate Cancer. Cancer Cell. 2019;35(3):414-427.e6.  PubMed