Anti ACACB pAb (ATL-HPA006554 w/enhanced validation)

Atlas Antibodies

SKU:
ATL-HPA006554-25
  • Immunohistochemistry analysis in human adipose tissue and cerebral cortex tissues using HPA006554 antibody. Corresponding ACACB RNA-seq data are presented for the same tissues.
  • Western blot analysis in human adipose tissue tissue.
Shipping:
Calculated at Checkout
$395.00
Adding to cart… The item has been added
Protein Description: acetyl-CoA carboxylase beta
Gene Name: ACACB
Alternative Gene Name: ACC2, ACCB, HACC275
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000042010: 56%, ENSRNOG00000000658: 57%
Entrez Gene ID: 32
Uniprot ID: O00763
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen ITKSKSEANLIPSQEPFPASDNSGETPQRNGEGHTLPKTPSQAEPASHKGPKDAGRRRNSLPPSHQKPPRNPLSSSDAAPSPELQANGTGTQGLEATDTNGLSSSARPQGQQAGSPSKEDKKQANIKRQLMTNFILGSFDDYSS
Gene Sequence ITKSKSEANLIPSQEPFPASDNSGETPQRNGEGHTLPKTPSQAEPASHKGPKDAGRRRNSLPPSHQKPPRNPLSSSDAAPSPELQANGTGTQGLEATDTNGLSSSARPQGQQAGSPSKEDKKQANIKRQLMTNFILGSFDDYSS
Gene ID - Mouse ENSMUSG00000042010
Gene ID - Rat ENSRNOG00000000658
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.


Documents & Links for Anti ACACB pAb (ATL-HPA006554 w/enhanced validation)
Datasheet Anti ACACB pAb (ATL-HPA006554 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti ACACB pAb (ATL-HPA006554 w/enhanced validation) at Atlas Antibodies

Documents & Links for Anti ACACB pAb (ATL-HPA006554 w/enhanced validation)
Datasheet Anti ACACB pAb (ATL-HPA006554 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti ACACB pAb (ATL-HPA006554 w/enhanced validation)



Citations for Anti ACACB pAb (ATL-HPA006554 w/enhanced validation) – 3 Found
Ma, Lijun; Murea, Mariana; Snipes, James A; Marinelarena, Alejandra; Krüger, Jacqueline; Hicks, Pamela J; Langberg, Kurt A; Bostrom, Meredith A; Cooke, Jessica N; Suzuki, Daisuke; Babazono, Tetsuya; Uzu, Takashi; Tang, Sydney C W; Mondal, Ashis K; Sharma, Neeraj K; Kobes, Sayuko; Antinozzi, Peter A; Davis, Matthew; Das, Swapan K; Rasouli, Neda; Kern, Philip A; Shores, Nathan J; Rudel, Lawrence L; Blüher, Matthias; Stumvoll, Michael; Bowden, Donald W; Maeda, Shiro; Parks, John S; Kovacs, Peter; Hanson, Robert L; Baier, Leslie J; Elbein, Steven C; Freedman, Barry I. An ACACB variant implicated in diabetic nephropathy associates with body mass index and gene expression in obese subjects. Plos One. 8(2):e56193.  PubMed
Pan, Wen-Ya; Zeng, Jiang-Hui; Wen, Dong-Yue; Wang, Jie-Yu; Wang, Peng-Peng; Chen, Gang; Feng, Zhen-Bo. Oncogenic value of microRNA-15b-5p in hepatocellular carcinoma and a bioinformatics investigation. Oncology Letters. 2019;17(2):1695-1713.  PubMed
Yang, Ji Hye; Kim, Nam Hee; Yun, Jun Seop; Cho, Eunae Sandra; Cha, Yong Hoon; Cho, Sue Bean; Lee, Seon-Hyeong; Cha, So Young; Kim, Soo-Youl; Choi, Jiwon; Nguyen, Tin-Tin Manh; Park, Sunghyouk; Kim, Hyun Sil; Yook, Jong In. Snail augments fatty acid oxidation by suppression of mitochondrial ACC2 during cancer progression. Life Science Alliance. 2020;3(7)  PubMed