Anti ACACA pAb (ATL-HPA063018)

Atlas Antibodies

Catalog No.: ATL-HPA063018-100

Protein Description: acetyl-CoA carboxylase alpha
Gene Name: ACACA
Alternative Gene Name: ACAC, ACC, ACC1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000020532: 94%, ENSRNOG00000008237: 31%
Entrez Gene ID: 31
Uniprot ID: Q13085
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: MDEPSPLAQPLELNQHSRFIIGSVSEDNSEDEISNLVKLDLLEEKEGSLSPASVGSDTLSDL
• Gene Sequence: MDEPSPLAQPLELNQHSRFIIGSVSEDNSEDEISNLVKLDLLEEKEGSLSPASVGSDTLSDL
• Gene ID - Mouse: ENSMUSG00000020532
• Gene ID - Rat: ENSRNOG00000008237
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Citations for Anti ACACA pAb (ATL-HPA063018) – 1 Found

Xiahou, Zhikai; Han, Jun. Effects of dehydroabietic acid on nontarget lipidomics and proteomics of HepG2. Frontiers In Pharmacology. 13( 36532744):1015240.