Anti ACACA pAb (ATL-HPA063018)

Atlas Antibodies

Catalog No.:
ATL-HPA063018-100
Shipping:
Calculated at Checkout
$593.00
Adding to cart… The item has been added
Protein Description: acetyl-CoA carboxylase alpha
Gene Name: ACACA
Alternative Gene Name: ACAC, ACC, ACC1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000020532: 94%, ENSRNOG00000008237: 31%
Entrez Gene ID: 31
Uniprot ID: Q13085
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen MDEPSPLAQPLELNQHSRFIIGSVSEDNSEDEISNLVKLDLLEEKEGSLSPASVGSDTLSDL
Gene Sequence MDEPSPLAQPLELNQHSRFIIGSVSEDNSEDEISNLVKLDLLEEKEGSLSPASVGSDTLSDL
Gene ID - Mouse ENSMUSG00000020532
Gene ID - Rat ENSRNOG00000008237
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti ACACA pAb (ATL-HPA063018)
Datasheet Anti ACACA pAb (ATL-HPA063018) Datasheet (External Link)
Vendor Page Anti ACACA pAb (ATL-HPA063018) at Atlas Antibodies

Documents & Links for Anti ACACA pAb (ATL-HPA063018)
Datasheet Anti ACACA pAb (ATL-HPA063018) Datasheet (External Link)
Vendor Page Anti ACACA pAb (ATL-HPA063018)
Citations for Anti ACACA pAb (ATL-HPA063018) – 1 Found
Xiahou, Zhikai; Han, Jun. Effects of dehydroabietic acid on nontarget lipidomics and proteomics of HepG2. Frontiers In Pharmacology. 13( 36532744):1015240.  PubMed