Anti ACACA pAb (ATL-HPA036650 w/enhanced validation)

Atlas Antibodies

SKU:
ATL-HPA036650-25
  • Immunofluorescent staining of human cell line U-251 MG shows localization to nucleoli fibrillar center, cytosol & actin filaments.
  • Western blot analysis in human cell line RT-4 and human cell line U-251 MG.
Shipping:
Calculated at Checkout
$395.00
Adding to cart… The item has been added
Protein Description: acetyl-CoA carboxylase alpha
Gene Name: ACACA
Alternative Gene Name: ACAC, ACC, ACC1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000020532: 94%, ENSRNOG00000008237: 31%
Entrez Gene ID: 31
Uniprot ID: Q13085
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen MDEPSPLAQPLELNQHSRFIIGSVSEDNSEDEISNLVKLDLLEEKEGSLSPASVGSDTLSDL
Gene Sequence MDEPSPLAQPLELNQHSRFIIGSVSEDNSEDEISNLVKLDLLEEKEGSLSPASVGSDTLSDL
Gene ID - Mouse ENSMUSG00000020532
Gene ID - Rat ENSRNOG00000008237
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.


Documents & Links for Anti ACACA pAb (ATL-HPA036650 w/enhanced validation)
Datasheet Anti ACACA pAb (ATL-HPA036650 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti ACACA pAb (ATL-HPA036650 w/enhanced validation) at Atlas Antibodies

Documents & Links for Anti ACACA pAb (ATL-HPA036650 w/enhanced validation)
Datasheet Anti ACACA pAb (ATL-HPA036650 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti ACACA pAb (ATL-HPA036650 w/enhanced validation)