Anti ACAA2 pAb (ATL-HPA042303)

Atlas Antibodies

Catalog No.:
ATL-HPA042303-100
Shipping:
Calculated at Checkout
$596.00
Adding to cart… The item has been added
Protein Description: acetyl-CoA acyltransferase 2
Gene Name: ACAA2
Alternative Gene Name: DSAEC
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000036880: 86%, ENSRNOG00000013766: 86%
Entrez Gene ID: 10449
Uniprot ID: P42765
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC, IHC
Reactivity Human, Mouse, Rat
Clonality Polyclonal
Host Rabbit
Immunogen LLRGVFVVAAKRTPFGAYGGLLKDFTATDLSEFAAKAALSAGKVSPETVDSVIMGNVLQSSSDAIYLARHVGLRVGIPKETPALTINRLCGSGFQSIVNGCQEICVKEAEVVLCGGTESMSQAPYCVRNVRFGTKLGSDIKLEDSLW
Gene Sequence LLRGVFVVAAKRTPFGAYGGLLKDFTATDLSEFAAKAALSAGKVSPETVDSVIMGNVLQSSSDAIYLARHVGLRVGIPKETPALTINRLCGSGFQSIVNGCQEICVKEAEVVLCGGTESMSQAPYCVRNVRFGTKLGSDIKLEDSLW
Gene ID - Mouse ENSMUSG00000036880
Gene ID - Rat ENSRNOG00000013766
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti ACAA2 pAb (ATL-HPA042303)
Datasheet Anti ACAA2 pAb (ATL-HPA042303) Datasheet (External Link)
Vendor Page Anti ACAA2 pAb (ATL-HPA042303) at Atlas Antibodies

Documents & Links for Anti ACAA2 pAb (ATL-HPA042303)
Datasheet Anti ACAA2 pAb (ATL-HPA042303) Datasheet (External Link)
Vendor Page Anti ACAA2 pAb (ATL-HPA042303)