Anti ACAA2 pAb (ATL-HPA042303)

Atlas Antibodies

SKU:
ATL-HPA042303-100
  • Immunohistochemical staining of human liver shows strong granular cytoplasmic positivity in hepatocytes.
  • Immunofluorescent staining of human cell line CACO-2 shows localization to mitochondria.
  • Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10<br/>Lane 2: Human cell line RT-4<br/>Lane 3: Human cell line U-251MG sp<br/>Lane 4: Human plasma (IgG/HSA depleted)<br/>Lane 5: Human liver tissue<br/>Lane 6: Human tonsil tissue
Shipping:
Calculated at Checkout
$596.00
Adding to cart… The item has been added
Protein Description: acetyl-CoA acyltransferase 2
Gene Name: ACAA2
Alternative Gene Name: DSAEC
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000036880: 86%, ENSRNOG00000013766: 86%
Entrez Gene ID: 10449
Uniprot ID: P42765
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC, IHC
Reactivity Human, Mouse, Rat
Clonality Polyclonal
Host Rabbit
Immunogen LLRGVFVVAAKRTPFGAYGGLLKDFTATDLSEFAAKAALSAGKVSPETVDSVIMGNVLQSSSDAIYLARHVGLRVGIPKETPALTINRLCGSGFQSIVNGCQEICVKEAEVVLCGGTESMSQAPYCVRNVRFGTKLGSDIKLEDSLW
Gene Sequence LLRGVFVVAAKRTPFGAYGGLLKDFTATDLSEFAAKAALSAGKVSPETVDSVIMGNVLQSSSDAIYLARHVGLRVGIPKETPALTINRLCGSGFQSIVNGCQEICVKEAEVVLCGGTESMSQAPYCVRNVRFGTKLGSDIKLEDSLW
Gene ID - Mouse ENSMUSG00000036880
Gene ID - Rat ENSRNOG00000013766
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.


Documents & Links for Anti ACAA2 pAb (ATL-HPA042303)
Datasheet Anti ACAA2 pAb (ATL-HPA042303) Datasheet (External Link)
Vendor Page Anti ACAA2 pAb (ATL-HPA042303) at Atlas Antibodies

Documents & Links for Anti ACAA2 pAb (ATL-HPA042303)
Datasheet Anti ACAA2 pAb (ATL-HPA042303) Datasheet (External Link)
Vendor Page Anti ACAA2 pAb (ATL-HPA042303)