Anti ACAA1 pAb (ATL-HPA007244 w/enhanced validation)

Atlas Antibodies

Catalog No.:
ATL-HPA007244-25
Shipping:
Calculated at Checkout
$324.00
Adding to cart… The item has been added
Protein Description: acetyl-CoA acyltransferase 1
Gene Name: ACAA1
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000010651: 88%, ENSRNOG00000032908: 87%
Entrez Gene ID: 30
Uniprot ID: P09110
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, ICC, IHC
Reactivity Human, Mouse, Rat
Clonality Polyclonal
Host Rabbit
Immunogen VLKDVNLRPEQLGDICVGNVLQPGAGAIMARIAQFLSDIPETVPLSTVNRQCSSGLQAVASIAGGIRNGSYDIGMACGVESMSLADRGNPGNITSRLMEKEKARDCLIPMGITSENVAERFGISREKQ
Gene Sequence VLKDVNLRPEQLGDICVGNVLQPGAGAIMARIAQFLSDIPETVPLSTVNRQCSSGLQAVASIAGGIRNGSYDIGMACGVESMSLADRGNPGNITSRLMEKEKARDCLIPMGITSENVAERFGISREKQ
Gene ID - Mouse ENSMUSG00000010651
Gene ID - Rat ENSRNOG00000032908
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti ACAA1 pAb (ATL-HPA007244 w/enhanced validation)
Datasheet Anti ACAA1 pAb (ATL-HPA007244 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti ACAA1 pAb (ATL-HPA007244 w/enhanced validation) at Atlas Antibodies

Documents & Links for Anti ACAA1 pAb (ATL-HPA007244 w/enhanced validation)
Datasheet Anti ACAA1 pAb (ATL-HPA007244 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti ACAA1 pAb (ATL-HPA007244 w/enhanced validation)
Citations for Anti ACAA1 pAb (ATL-HPA007244 w/enhanced validation) – 8 Found
Klouwer, Femke C C; Koster, Janet; Ferdinandusse, Sacha; Waterham, Hans R. Peroxisomal abnormalities in the immortalized human hepatocyte (IHH) cell line. Histochemistry And Cell Biology. 2017;147(4):537-541.  PubMed
Falkenberg, Kim D; Braverman, Nancy E; Moser, Ann B; Steinberg, Steven J; Klouwer, Femke C C; Schlüter, Agatha; Ruiz, Montserrat; Pujol, Aurora; Engvall, Martin; Naess, Karin; van Spronsen, FrancJan; Körver-Keularts, Irene; Rubio-Gozalbo, M Estela; Ferdinandusse, Sacha; Wanders, Ronald J A; Waterham, Hans R. Allelic Expression Imbalance Promoting a Mutant PEX6 Allele Causes Zellweger Spectrum Disorder. American Journal Of Human Genetics. 2017;101(6):965-976.  PubMed
Torres, Sandra Elizabeth; Gallagher, Ciara M; Plate, Lars; Gupta, Meghna; Liem, Christina R; Guo, Xiaoyan; Tian, Ruilin; Stroud, Robert M; Kampmann, Martin; Weissman, Jonathan S; Walter, Peter. Ceapins block the unfolded protein response sensor ATF6α by inducing a neomorphic inter-organelle tether. Elife. 2019;8( 31149896)  PubMed
de la Calle Arregui, Celia; Plata-Gómez, Ana Belén; Deleyto-Seldas, Nerea; García, Fernando; Ortega-Molina, Ana; Abril-Garrido, Julio; Rodriguez, Elena; Nemazanyy, Ivan; Tribouillard, Laura; de Martino, Alba; Caleiras, Eduardo; Campos-Olivas, Ramón; Mulero, Francisca; Laplante, Mathieu; Muñoz, Javier; Pende, Mario; Sabio, Guadalupe; Sabatini, David M; Efeyan, Alejo. Limited survival and impaired hepatic fasting metabolism in mice with constitutive Rag GTPase signaling. Nature Communications. 2021;12(1):3660.  PubMed
da Silva, Tiago Ferreira; Eira, Jessica; Lopes, André T; Malheiro, Ana R; Sousa, Vera; Luoma, Adrienne; Avila, Robin L; Wanders, Ronald J A; Just, Wilhelm W; Kirschner, Daniel A; Sousa, Mónica M; Brites, Pedro. Peripheral nervous system plasmalogens regulate Schwann cell differentiation and myelination. The Journal Of Clinical Investigation. 2014;124(6):2560-70.  PubMed
Moruno-Manchon, Jose F; Uzor, Ndidi-Ese; Kesler, Shelli R; Wefel, Jeffrey S; Townley, Debra M; Nagaraja, Archana Sidalaghatta; Pradeep, Sunila; Mangala, Lingegowda S; Sood, Anil K; Tsvetkov, Andrey S. Peroxisomes contribute to oxidative stress in neurons during doxorubicin-based chemotherapy. Molecular And Cellular Neurosciences. 2018;86( 29180229):65-71.  PubMed
Zhang, Xiuzhi; Yang, Hongmei; Zhang, Jinzhong; Gao, Fenglan; Dai, Liping. HSD17B4, ACAA1, and PXMP4 in Peroxisome Pathway Are Down-Regulated and Have Clinical Significance in Non-small Cell Lung Cancer. Frontiers In Genetics. 11( 32265992):273.  PubMed
Klouwer, Femke C C; Falkenberg, Kim D; Ofman, Rob; Koster, Janet; van Gent, Démi; Ferdinandusse, Sacha; Wanders, Ronald J A; Waterham, Hans R. Autophagy Inhibitors Do Not Restore Peroxisomal Functions in Cells With the Most Common Peroxisome Biogenesis Defect. Frontiers In Cell And Developmental Biology. 9( 33869228):661298.  PubMed