Anti ACAA1 pAb (ATL-HPA006764 w/enhanced validation)

Atlas Antibodies

Catalog No.:
ATL-HPA006764-25
Shipping:
Calculated at Checkout
$324.00
Adding to cart… The item has been added
Protein Description: acetyl-CoA acyltransferase 1
Gene Name: ACAA1
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000036138: 95%, ENSRNOG00000032908: 96%
Entrez Gene ID: 30
Uniprot ID: P09110
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, ICC, IHC
Reactivity Human, Mouse, Rat
Clonality Polyclonal
Host Rabbit
Immunogen GNSSQVSDGAAAILLARRSKAEELGLPILGVLRSYAVVGVPPDIMGIGPAYAIPVA
Gene Sequence GNSSQVSDGAAAILLARRSKAEELGLPILGVLRSYAVVGVPPDIMGIGPAYAIPVA
Gene ID - Mouse ENSMUSG00000036138
Gene ID - Rat ENSRNOG00000032908
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti ACAA1 pAb (ATL-HPA006764 w/enhanced validation)
Datasheet Anti ACAA1 pAb (ATL-HPA006764 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti ACAA1 pAb (ATL-HPA006764 w/enhanced validation) at Atlas Antibodies

Documents & Links for Anti ACAA1 pAb (ATL-HPA006764 w/enhanced validation)
Datasheet Anti ACAA1 pAb (ATL-HPA006764 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti ACAA1 pAb (ATL-HPA006764 w/enhanced validation)