Anti ACAA1 pAb (ATL-HPA006764 w/enhanced validation)
Atlas Antibodies
- Catalog No.:
- ATL-HPA006764-25
- Shipping:
- Calculated at Checkout
$303.00
Gene Name: ACAA1
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000036138: 95%, ENSRNOG00000032908: 96%
Entrez Gene ID: 30
Uniprot ID: P09110
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | WB, ICC, IHC |
| Reactivity | Human, Mouse, Rat |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | GNSSQVSDGAAAILLARRSKAEELGLPILGVLRSYAVVGVPPDIMGIGPAYAIPVA |
| Gene Sequence | GNSSQVSDGAAAILLARRSKAEELGLPILGVLRSYAVVGVPPDIMGIGPAYAIPVA |
| Gene ID - Mouse | ENSMUSG00000036138 |
| Gene ID - Rat | ENSRNOG00000032908 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti ACAA1 pAb (ATL-HPA006764 w/enhanced validation) | |
| Datasheet | Anti ACAA1 pAb (ATL-HPA006764 w/enhanced validation) Datasheet (External Link) |
| Vendor Page | Anti ACAA1 pAb (ATL-HPA006764 w/enhanced validation) at Atlas Antibodies |
| Documents & Links for Anti ACAA1 pAb (ATL-HPA006764 w/enhanced validation) | |
| Datasheet | Anti ACAA1 pAb (ATL-HPA006764 w/enhanced validation) Datasheet (External Link) |
| Vendor Page | Anti ACAA1 pAb (ATL-HPA006764 w/enhanced validation) |