Anti ABTB2 pAb (ATL-HPA030699)
Atlas Antibodies
- Catalog No.:
- ATL-HPA030699-25
- Shipping:
- Calculated at Checkout
$478.00
Gene Name: ABTB2
Alternative Gene Name: ABTB2A, BTBD22, DKFZP586C1619
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000032724: 97%, ENSRNOG00000008510: 97%
Entrez Gene ID: 25841
Uniprot ID: Q8N961
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | ICC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | MVDTRISVRIHEYAAISLTACMENLVEEIRARVMASHSPDGGGAGGGEVSAEALEMVINNDAELWGVLQPYEH |
| Gene Sequence | MVDTRISVRIHEYAAISLTACMENLVEEIRARVMASHSPDGGGAGGGEVSAEALEMVINNDAELWGVLQPYEH |
| Gene ID - Mouse | ENSMUSG00000032724 |
| Gene ID - Rat | ENSRNOG00000008510 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti ABTB2 pAb (ATL-HPA030699) | |
| Datasheet | Anti ABTB2 pAb (ATL-HPA030699) Datasheet (External Link) |
| Vendor Page | Anti ABTB2 pAb (ATL-HPA030699) at Atlas Antibodies |
| Documents & Links for Anti ABTB2 pAb (ATL-HPA030699) | |
| Datasheet | Anti ABTB2 pAb (ATL-HPA030699) Datasheet (External Link) |
| Vendor Page | Anti ABTB2 pAb (ATL-HPA030699) |