Anti ABTB2 pAb (ATL-HPA030699)
Atlas Antibodies
- Catalog No.:
- ATL-HPA030699-25
- Shipping:
- Calculated at Checkout
$447.00
Gene Name: ABTB2
Alternative Gene Name: ABTB2A, BTBD22, DKFZP586C1619
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000032724: 97%, ENSRNOG00000008510: 97%
Entrez Gene ID: 25841
Uniprot ID: Q8N961
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | ICC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | MVDTRISVRIHEYAAISLTACMENLVEEIRARVMASHSPDGGGAGGGEVSAEALEMVINNDAELWGVLQPYEH |
Gene Sequence | MVDTRISVRIHEYAAISLTACMENLVEEIRARVMASHSPDGGGAGGGEVSAEALEMVINNDAELWGVLQPYEH |
Gene ID - Mouse | ENSMUSG00000032724 |
Gene ID - Rat | ENSRNOG00000008510 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links for Anti ABTB2 pAb (ATL-HPA030699) | |
Datasheet | Anti ABTB2 pAb (ATL-HPA030699) Datasheet (External Link) |
Vendor Page | Anti ABTB2 pAb (ATL-HPA030699) at Atlas Antibodies |
Documents & Links for Anti ABTB2 pAb (ATL-HPA030699) | |
Datasheet | Anti ABTB2 pAb (ATL-HPA030699) Datasheet (External Link) |
Vendor Page | Anti ABTB2 pAb (ATL-HPA030699) |