Anti ABTB2 pAb (ATL-HPA020065)

Atlas Antibodies

SKU: ATL-HPA020065-25

• 
• 

Protein Description: ankyrin repeat and BTB (POZ) domain containing 2
Gene Name: ABTB2
Alternative Gene Name: ABTB2A, BTBD22, DKFZP586C1619
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000032724: 95%, ENSRNOG00000008510: 95%
Entrez Gene ID: 25841
Uniprot ID: Q8N961
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: IPTTDILELLSAASLFQLDALQRHCEILCSQTLSMESAVNTYKYAKIHNAPELALFCEGFFLKHMKALLEQDA
• Gene Sequence: IPTTDILELLSAASLFQLDALQRHCEILCSQTLSMESAVNTYKYAKIHNAPELALFCEGFFLKHMKALLEQDA
• Gene ID - Mouse: ENSMUSG00000032724
• Gene ID - Rat: ENSRNOG00000008510
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.