Anti ABTB1 pAb (ATL-HPA035022)

Atlas Antibodies

Catalog No.:
ATL-HPA035022-25
Shipping:
Calculated at Checkout
$303.00
Adding to cart… The item has been added
Protein Description: ankyrin repeat and BTB (POZ) domain containing 1
Gene Name: ABTB1
Alternative Gene Name: BPOZ, Btb3, BTBD21, EF1ABP
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000030083: 95%, ENSRNOG00000015762: 96%
Entrez Gene ID: 80325
Uniprot ID: Q969K4
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen GVEHVSDCERLAKQCQLWDLLSDLEAKCEKVSEFVASKPGTCVKVLTIEPPPADPRLREDMALLADCALPPELRGDLWELPFPCPDGFNSCPDICFRVA
Gene Sequence GVEHVSDCERLAKQCQLWDLLSDLEAKCEKVSEFVASKPGTCVKVLTIEPPPADPRLREDMALLADCALPPELRGDLWELPFPCPDGFNSCPDICFRVA
Gene ID - Mouse ENSMUSG00000030083
Gene ID - Rat ENSRNOG00000015762
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti ABTB1 pAb (ATL-HPA035022)
Datasheet Anti ABTB1 pAb (ATL-HPA035022) Datasheet (External Link)
Vendor Page Anti ABTB1 pAb (ATL-HPA035022) at Atlas Antibodies

Documents & Links for Anti ABTB1 pAb (ATL-HPA035022)
Datasheet Anti ABTB1 pAb (ATL-HPA035022) Datasheet (External Link)
Vendor Page Anti ABTB1 pAb (ATL-HPA035022)