Anti ABTB1 pAb (ATL-HPA035022)

Atlas Antibodies

SKU: ATL-HPA035022-25

• 
• 

Protein Description: ankyrin repeat and BTB (POZ) domain containing 1
Gene Name: ABTB1
Alternative Gene Name: BPOZ, Btb3, BTBD21, EF1ABP
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000030083: 95%, ENSRNOG00000015762: 96%
Entrez Gene ID: 80325
Uniprot ID: Q969K4
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: GVEHVSDCERLAKQCQLWDLLSDLEAKCEKVSEFVASKPGTCVKVLTIEPPPADPRLREDMALLADCALPPELRGDLWELPFPCPDGFNSCPDICFRVA
• Gene Sequence: GVEHVSDCERLAKQCQLWDLLSDLEAKCEKVSEFVASKPGTCVKVLTIEPPPADPRLREDMALLADCALPPELRGDLWELPFPCPDGFNSCPDICFRVA
• Gene ID - Mouse: ENSMUSG00000030083
• Gene ID - Rat: ENSRNOG00000015762
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.