Anti ABTB1 pAb (ATL-HPA035022)
Atlas Antibodies
- Catalog No.:
- ATL-HPA035022-25
- Shipping:
- Calculated at Checkout
$303.00
Gene Name: ABTB1
Alternative Gene Name: BPOZ, Btb3, BTBD21, EF1ABP
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000030083: 95%, ENSRNOG00000015762: 96%
Entrez Gene ID: 80325
Uniprot ID: Q969K4
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | ICC, IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | GVEHVSDCERLAKQCQLWDLLSDLEAKCEKVSEFVASKPGTCVKVLTIEPPPADPRLREDMALLADCALPPELRGDLWELPFPCPDGFNSCPDICFRVA |
| Gene Sequence | GVEHVSDCERLAKQCQLWDLLSDLEAKCEKVSEFVASKPGTCVKVLTIEPPPADPRLREDMALLADCALPPELRGDLWELPFPCPDGFNSCPDICFRVA |
| Gene ID - Mouse | ENSMUSG00000030083 |
| Gene ID - Rat | ENSRNOG00000015762 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti ABTB1 pAb (ATL-HPA035022) | |
| Datasheet | Anti ABTB1 pAb (ATL-HPA035022) Datasheet (External Link) |
| Vendor Page | Anti ABTB1 pAb (ATL-HPA035022) at Atlas Antibodies |
| Documents & Links for Anti ABTB1 pAb (ATL-HPA035022) | |
| Datasheet | Anti ABTB1 pAb (ATL-HPA035022) Datasheet (External Link) |
| Vendor Page | Anti ABTB1 pAb (ATL-HPA035022) |