Anti ABT1 pAb (ATL-HPA077039)

Atlas Antibodies

Catalog No.: ATL-HPA077039-25

Protein Description: activator of basal transcription 1
Gene Name: ABT1
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000036376: 88%, ENSRNOG00000017585: 89%
Entrez Gene ID: 29777
Uniprot ID: Q9ULW3
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC, ChIP-Exo-Seq
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: SKKRVVPGIVYLGHIPPRFRPLHVRNLLSAYGEVGRVFFQAEDRFVRRKKKAAAAAGGKKRSYTKDYTEGWVEFR
• Gene Sequence: SKKRVVPGIVYLGHIPPRFRPLHVRNLLSAYGEVGRVFFQAEDRFVRRKKKAAAAAGGKKRSYTKDYTEGWVEFR
• Gene ID - Mouse: ENSMUSG00000036376
• Gene ID - Rat: ENSRNOG00000017585
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.