Anti ABR pAb (ATL-HPA053618)

Atlas Antibodies

Catalog No.:
ATL-HPA053618-25
Shipping:
Calculated at Checkout
$478.00
Adding to cart… The item has been added
Protein Description: active BCR-related
Gene Name: ABR
Alternative Gene Name: MDB
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000017631: 91%, ENSRNOG00000056837: 86%
Entrez Gene ID: 29
Uniprot ID: Q12979
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen LYSNFSYGTDEYDGEGNEEQKGPPEGSETMPYIDESPTMSPQLSARSQGGGDGVSPTPPEGLAPGVEAGK
Gene Sequence LYSNFSYGTDEYDGEGNEEQKGPPEGSETMPYIDESPTMSPQLSARSQGGGDGVSPTPPEGLAPGVEAGK
Gene ID - Mouse ENSMUSG00000017631
Gene ID - Rat ENSRNOG00000056837
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti ABR pAb (ATL-HPA053618)
Datasheet Anti ABR pAb (ATL-HPA053618) Datasheet (External Link)
Vendor Page Anti ABR pAb (ATL-HPA053618) at Atlas Antibodies

Documents & Links for Anti ABR pAb (ATL-HPA053618)
Datasheet Anti ABR pAb (ATL-HPA053618) Datasheet (External Link)
Vendor Page Anti ABR pAb (ATL-HPA053618)