Anti ABLIM3 pAb (ATL-HPA003245)

Atlas Antibodies

Catalog No.: ATL-HPA003245-25

Protein Description: actin binding LIM protein family, member 3
Gene Name: ABLIM3
Alternative Gene Name: KIAA0843
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000032735: 97%, ENSRNOG00000019365: 97%
Entrez Gene ID: 22885
Uniprot ID: O94929
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, ICC, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: DLSTATKSKTSEDISQTSKYSPIYSPDPYYASESEYWTYHGSPKVPRARRFSSGGEEDDFDRSMHKLQSGIGRLILKEEMKARSSSYADPWTPPRSSTSSREALHTAGYEMSLNGSPRSHYLADSDPLISKSASLPAYRRNGLHRT
• Gene Sequence: DLSTATKSKTSEDISQTSKYSPIYSPDPYYASESEYWTYHGSPKVPRARRFSSGGEEDDFDRSMHKLQSGIGRLILKEEMKARSSSYADPWTPPRSSTSSREALHTAGYEMSLNGSPRSHYLADSDPLISKSASLPAYRRNGLHRT
• Gene ID - Mouse: ENSMUSG00000032735
• Gene ID - Rat: ENSRNOG00000019365
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Citations for Anti ABLIM3 pAb (ATL-HPA003245) – 4 Found

Li, Amy; Ponten, Fredrik; dos Remedios, Cristobal G. The interactome of LIM domain proteins: the contributions of LIM domain proteins to heart failure and heart development. Proteomics. 2012;12(2):203-25. 

Cao, Jingli; Shen, Yidong; Zhu, Lei; Xu, Yanan; Zhou, Yizhuo; Wu, Zhili; Li, Yiping; Yan, Xiumin; Zhu, Xueliang. miR-129-3p controls cilia assembly by regulating CP110 and actin dynamics. Nature Cell Biology. 2012;14(7):697-706. 

Lee, Jandee; Jeong, Seonhyang; Lee, Cho Rok; Ku, Cheol Ryong; Kang, Sang-Wook; Jeong, Jong Ju; Nam, Kee-Hyun; Shin, Dong Yeob; Chung, Woong Youn; Lee, Eun Jig; Jo, Young Suk. GLI1 Transcription Factor Affects Tumor Aggressiveness in Patients With Papillary Thyroid Cancers. Medicine. 2015;94(25):e998. 

Fearnley, Gareth W; Young, Katherine A; Edgar, James R; Antrobus, Robin; Hay, Iain M; Liang, Wei-Ching; Martinez-Martin, Nadia; Lin, WeiYu; Deane, Janet E; Sharpe, Hayley J. The homophilic receptor PTPRK selectively dephosphorylates multiple junctional regulators to promote cell-cell adhesion. Elife. 2019;8( 30924770)