Anti ABLIM1 pAb (ATL-HPA038952)

Atlas Antibodies

SKU:
ATL-HPA038952-25
  • Immunohistochemical staining of human esophagus shows strong cytoplasmic and membranous positivity in squamous epithelial cells.
  • Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10<br/>Lane 2: Human cell line RT-4<br/>Lane 3: Human cell line U-251MG sp
Shipping:
Calculated at Checkout
$447.00
Adding to cart… The item has been added
Protein Description: actin binding LIM protein 1
Gene Name: ABLIM1
Alternative Gene Name: ABLIM, LIMAB1, limatin
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000025085: 93%, ENSRNOG00000046333: 72%
Entrez Gene ID: 3983
Uniprot ID: O14639
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen QGSTVWHPDCKQSTKTEEKLRLPNIRRSSSDFFYSKSLIRRTGRSPSLQPTRTSS
Gene Sequence QGSTVWHPDCKQSTKTEEKLRLPNIRRSSSDFFYSKSLIRRTGRSPSLQPTRTSS
Gene ID - Mouse ENSMUSG00000025085
Gene ID - Rat ENSRNOG00000046333
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.


Documents & Links for Anti ABLIM1 pAb (ATL-HPA038952)
Datasheet Anti ABLIM1 pAb (ATL-HPA038952) Datasheet (External Link)
Vendor Page Anti ABLIM1 pAb (ATL-HPA038952) at Atlas Antibodies

Documents & Links for Anti ABLIM1 pAb (ATL-HPA038952)
Datasheet Anti ABLIM1 pAb (ATL-HPA038952) Datasheet (External Link)
Vendor Page Anti ABLIM1 pAb (ATL-HPA038952)