Anti ABLIM1 pAb (ATL-HPA038952)

Atlas Antibodies

SKU: ATL-HPA038952-25

• 
• 

Protein Description: actin binding LIM protein 1
Gene Name: ABLIM1
Alternative Gene Name: ABLIM, LIMAB1, limatin
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000025085: 93%, ENSRNOG00000046333: 72%
Entrez Gene ID: 3983
Uniprot ID: O14639
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: QGSTVWHPDCKQSTKTEEKLRLPNIRRSSSDFFYSKSLIRRTGRSPSLQPTRTSS
• Gene Sequence: QGSTVWHPDCKQSTKTEEKLRLPNIRRSSSDFFYSKSLIRRTGRSPSLQPTRTSS
• Gene ID - Mouse: ENSMUSG00000025085
• Gene ID - Rat: ENSRNOG00000046333
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.