Anti ABL2 pAb (ATL-HPA072754)

Atlas Antibodies

SKU: ATL-HPA072754-25

• 

Protein Description: ABL proto-oncogene 2, non-receptor tyrosine kinase
Gene Name: ABL2
Alternative Gene Name: ABLL, ARG
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000026596: 86%, ENSRNOG00000004305: 88%
Entrez Gene ID: 27
Uniprot ID: P42684
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: SSSSVVPYLPRLPILPSKTRTLKKQVENKENIEGAQDATENSASSLAPGFIRGAQASSGSPALPRKQRDKSPSSLLEDAKETCFTRDRKGGFFSSF
• Gene Sequence: SSSSVVPYLPRLPILPSKTRTLKKQVENKENIEGAQDATENSASSLAPGFIRGAQASSGSPALPRKQRDKSPSSLLEDAKETCFTRDRKGGFFSSF
• Gene ID - Mouse: ENSMUSG00000026596
• Gene ID - Rat: ENSRNOG00000004305
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.