Anti ABL1 pAb (ATL-HPA028409)
Atlas Antibodies
- SKU:
- ATL-HPA028409-25
- Shipping:
- Calculated at Checkout
$328.00
Gene Name: ABL1
Alternative Gene Name: ABL, c-ABL, JTK7, p150
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000026842: 75%, ENSRNOG00000047356: 77%
Entrez Gene ID: 25
Uniprot ID: P00519
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | ICC, IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | PTPPKRSSSFREMDGQPERRGAGEEEGRDISNGALAFTPLDTADPAKSPKPSNGAGVPNGALRESGGSGFRSPHLWKKSSTLT |
| Gene Sequence | PTPPKRSSSFREMDGQPERRGAGEEEGRDISNGALAFTPLDTADPAKSPKPSNGAGVPNGALRESGGSGFRSPHLWKKSSTLT |
| Gene ID - Mouse | ENSMUSG00000026842 |
| Gene ID - Rat | ENSRNOG00000047356 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti ABL1 pAb (ATL-HPA028409) | |
| Datasheet | Anti ABL1 pAb (ATL-HPA028409) Datasheet (External Link) |
| Vendor Page | Anti ABL1 pAb (ATL-HPA028409) at Atlas Antibodies |
| Documents & Links for Anti ABL1 pAb (ATL-HPA028409) | |
| Datasheet | Anti ABL1 pAb (ATL-HPA028409) Datasheet (External Link) |
| Vendor Page | Anti ABL1 pAb (ATL-HPA028409) |
| Citations for Anti ABL1 pAb (ATL-HPA028409) – 1 Found |
| Sun, Yifeng; Chen, Chang; Zhang, Peng; Xie, Huikang; Hou, Likun; Hui, Zheng; Xu, Yongjie; Du, Qiaoling; Zhou, Xiao; Su, Bo; Gao, Wen. Reduced miR-3127-5p expression promotes NSCLC proliferation/invasion and contributes to dasatinib sensitivity via the c-Abl/Ras/ERK pathway. Scientific Reports. 2014;4( 25284075):6527. PubMed |