Anti ABL1 pAb (ATL-HPA028409)

Atlas Antibodies

Catalog No.:
ATL-HPA028409-25
Shipping:
Calculated at Checkout
$351.00
Adding to cart… The item has been added
Protein Description: ABL proto-oncogene 1, non-receptor tyrosine kinase
Gene Name: ABL1
Alternative Gene Name: ABL, c-ABL, JTK7, p150
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000026842: 75%, ENSRNOG00000047356: 77%
Entrez Gene ID: 25
Uniprot ID: P00519
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen PTPPKRSSSFREMDGQPERRGAGEEEGRDISNGALAFTPLDTADPAKSPKPSNGAGVPNGALRESGGSGFRSPHLWKKSSTLT
Gene Sequence PTPPKRSSSFREMDGQPERRGAGEEEGRDISNGALAFTPLDTADPAKSPKPSNGAGVPNGALRESGGSGFRSPHLWKKSSTLT
Gene ID - Mouse ENSMUSG00000026842
Gene ID - Rat ENSRNOG00000047356
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti ABL1 pAb (ATL-HPA028409)
Datasheet Anti ABL1 pAb (ATL-HPA028409) Datasheet (External Link)
Vendor Page Anti ABL1 pAb (ATL-HPA028409) at Atlas Antibodies

Documents & Links for Anti ABL1 pAb (ATL-HPA028409)
Datasheet Anti ABL1 pAb (ATL-HPA028409) Datasheet (External Link)
Vendor Page Anti ABL1 pAb (ATL-HPA028409)
Citations for Anti ABL1 pAb (ATL-HPA028409) – 1 Found
Sun, Yifeng; Chen, Chang; Zhang, Peng; Xie, Huikang; Hou, Likun; Hui, Zheng; Xu, Yongjie; Du, Qiaoling; Zhou, Xiao; Su, Bo; Gao, Wen. Reduced miR-3127-5p expression promotes NSCLC proliferation/invasion and contributes to dasatinib sensitivity via the c-Abl/Ras/ERK pathway. Scientific Reports. 2014;4( 25284075):6527.  PubMed