Anti ABL1 pAb (ATL-HPA027280)
Atlas Antibodies
- Catalog No.:
- ATL-HPA027280-25
- Shipping:
- Calculated at Checkout
$328.00
Gene Name: ABL1
Alternative Gene Name: ABL, c-ABL, JTK7, p150
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000026842: 79%, ENSRNOG00000047356: 79%
Entrez Gene ID: 25
Uniprot ID: P00519
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | ICC, IHC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | TEWRSVTLPRDLQSTGRQFDSSTFGGHKSEKPALPRKRAGENRSDQVTRGTVTPPPRLVKKNEEAADEVFKDIMESSP |
Gene Sequence | TEWRSVTLPRDLQSTGRQFDSSTFGGHKSEKPALPRKRAGENRSDQVTRGTVTPPPRLVKKNEEAADEVFKDIMESSP |
Gene ID - Mouse | ENSMUSG00000026842 |
Gene ID - Rat | ENSRNOG00000047356 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links for Anti ABL1 pAb (ATL-HPA027280) | |
Datasheet | Anti ABL1 pAb (ATL-HPA027280) Datasheet (External Link) |
Vendor Page | Anti ABL1 pAb (ATL-HPA027280) at Atlas Antibodies |
Documents & Links for Anti ABL1 pAb (ATL-HPA027280) | |
Datasheet | Anti ABL1 pAb (ATL-HPA027280) Datasheet (External Link) |
Vendor Page | Anti ABL1 pAb (ATL-HPA027280) |