Anti ABL1 pAb (ATL-HPA027280)

Atlas Antibodies

Catalog No.: ATL-HPA027280-25

Protein Description: ABL proto-oncogene 1, non-receptor tyrosine kinase
Gene Name: ABL1
Alternative Gene Name: ABL, c-ABL, JTK7, p150
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000026842: 79%, ENSRNOG00000047356: 79%
Entrez Gene ID: 25
Uniprot ID: P00519
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: TEWRSVTLPRDLQSTGRQFDSSTFGGHKSEKPALPRKRAGENRSDQVTRGTVTPPPRLVKKNEEAADEVFKDIMESSP
• Gene Sequence: TEWRSVTLPRDLQSTGRQFDSSTFGGHKSEKPALPRKRAGENRSDQVTRGTVTPPPRLVKKNEEAADEVFKDIMESSP
• Gene ID - Mouse: ENSMUSG00000026842
• Gene ID - Rat: ENSRNOG00000047356
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.