Anti ABI2 pAb (ATL-HPA062433)

Atlas Antibodies

Catalog No.:
ATL-HPA062433-25
Shipping:
Calculated at Checkout
$478.00
Adding to cart… The item has been added
Protein Description: abl-interactor 2
Gene Name: ABI2
Alternative Gene Name: ABI-2, ABI2B, AblBP3, AIP-1, argBPIA, SSH3BP2
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000026782: 94%, ENSRNOG00000017707: 51%
Entrez Gene ID: 10152
Uniprot ID:
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen PSSTAPDAAAGGAQTLADGFTSPTPPVVSSTPPTGHPVQFYSMNRPASRHT
Gene Sequence PSSTAPDAAAGGAQTLADGFTSPTPPVVSSTPPTGHPVQFYSMNRPASRHT
Gene ID - Mouse ENSMUSG00000026782
Gene ID - Rat ENSRNOG00000017707
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti ABI2 pAb (ATL-HPA062433)
Datasheet Anti ABI2 pAb (ATL-HPA062433) Datasheet (External Link)
Vendor Page Anti ABI2 pAb (ATL-HPA062433) at Atlas Antibodies

Documents & Links for Anti ABI2 pAb (ATL-HPA062433)
Datasheet Anti ABI2 pAb (ATL-HPA062433) Datasheet (External Link)
Vendor Page Anti ABI2 pAb (ATL-HPA062433)