Anti ABI1 pAb (ATL-HPA068407)

Atlas Antibodies

SKU:
ATL-HPA068407-25
  • Immunofluorescent staining of human cell line U-2 OS shows localization to plasma membrane & cell junctions.
Shipping:
Calculated at Checkout
$303.00
Adding to cart… The item has been added
Protein Description: abl-interactor 1
Gene Name: ABI1
Alternative Gene Name: ABI-1, E3B1, SSH3BP1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000058835: 98%, ENSRNOG00000031325: 100%
Entrez Gene ID: 10006
Uniprot ID: Q8IZP0
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen SQYGTMTRQISRHNSTTSSTSSGGYRRTPSVTAQFSAQPHVNGGPLYSQ
Gene Sequence SQYGTMTRQISRHNSTTSSTSSGGYRRTPSVTAQFSAQPHVNGGPLYSQ
Gene ID - Mouse ENSMUSG00000058835
Gene ID - Rat ENSRNOG00000031325
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.


Documents & Links for Anti ABI1 pAb (ATL-HPA068407)
Datasheet Anti ABI1 pAb (ATL-HPA068407) Datasheet (External Link)
Vendor Page Anti ABI1 pAb (ATL-HPA068407) at Atlas Antibodies

Documents & Links for Anti ABI1 pAb (ATL-HPA068407)
Datasheet Anti ABI1 pAb (ATL-HPA068407) Datasheet (External Link)
Vendor Page Anti ABI1 pAb (ATL-HPA068407)