Anti ABHD8 pAb (ATL-HPA037658 w/enhanced validation)

Atlas Antibodies

SKU:
ATL-HPA037658-25
  • Immunohistochemical staining of human stomach shows strong membranous positivity in glandular cells.
  • Western blot analysis in control (vector only transfected HEK293T lysate) and ABHD8 over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (~3.1 kDa) in mammalian HEK293T cells, LY411270).
Shipping:
Calculated at Checkout
$447.00
Adding to cart… The item has been added
Protein Description: abhydrolase domain containing 8
Gene Name: ABHD8
Alternative Gene Name: FLJ11743, MGC14280, MGC2512
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000007950: 99%, ENSRNOG00000000054: 99%
Entrez Gene ID: 79575
Uniprot ID: Q96I13
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen RQGAKEKQLLKEGNAFNVSSFVLRAMMSGQYWPEGDEVYHAELTVPVLLVHGMHDKFVPVEEDQRMAEILLLAFLKLIDEGSHMVMLECPETV
Gene Sequence RQGAKEKQLLKEGNAFNVSSFVLRAMMSGQYWPEGDEVYHAELTVPVLLVHGMHDKFVPVEEDQRMAEILLLAFLKLIDEGSHMVMLECPETV
Gene ID - Mouse ENSMUSG00000007950
Gene ID - Rat ENSRNOG00000000054
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.


Documents & Links for Anti ABHD8 pAb (ATL-HPA037658 w/enhanced validation)
Datasheet Anti ABHD8 pAb (ATL-HPA037658 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti ABHD8 pAb (ATL-HPA037658 w/enhanced validation) at Atlas Antibodies

Documents & Links for Anti ABHD8 pAb (ATL-HPA037658 w/enhanced validation)
Datasheet Anti ABHD8 pAb (ATL-HPA037658 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti ABHD8 pAb (ATL-HPA037658 w/enhanced validation)