Anti ABHD6 pAb (ATL-HPA073225)

Atlas Antibodies

Catalog No.:
ATL-HPA073225-25
Shipping:
Calculated at Checkout
$303.00
Adding to cart… The item has been added
Protein Description: abhydrolase domain containing 6
Gene Name: ABHD6
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000025277: 86%, ENSRNOG00000008167: 87%
Entrez Gene ID: 57406
Uniprot ID: Q9BV23
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen GKQDQVLDVSGADMLAKSIANCQVELLENCGHSVVMERPRKTAKLIIDFLASVHNTDNNKKLD
Gene Sequence GKQDQVLDVSGADMLAKSIANCQVELLENCGHSVVMERPRKTAKLIIDFLASVHNTDNNKKLD
Gene ID - Mouse ENSMUSG00000025277
Gene ID - Rat ENSRNOG00000008167
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti ABHD6 pAb (ATL-HPA073225)
Datasheet Anti ABHD6 pAb (ATL-HPA073225) Datasheet (External Link)
Vendor Page Anti ABHD6 pAb (ATL-HPA073225) at Atlas Antibodies

Documents & Links for Anti ABHD6 pAb (ATL-HPA073225)
Datasheet Anti ABHD6 pAb (ATL-HPA073225) Datasheet (External Link)
Vendor Page Anti ABHD6 pAb (ATL-HPA073225)